KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1236
Entry
ZMO1236           CDS       T00221                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00350  Tyrosine metabolism
zmo00620  Pyruvate metabolism
zmo00625  Chloroalkane and chloroalkene degradation
zmo00626  Naphthalene degradation
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1236
   00620 Pyruvate metabolism
    ZMO1236
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ZMO1236
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ZMO1236
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZMO1236
   00626 Naphthalene degradation
    ZMO1236
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZMO1236
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Methyltransf_25 CoA_binding TrkA_N 2-Hacid_dh_C PEPcase_2
Other DBs
NCBI-ProteinID: AAV89860
UniProt: P20368
Position
complement(1259369..1260382)
AA seq 337 aa
MKAAVITKDHTIEVKDTKLRPLKYGEALLEMEYCGVCHTDLHVKNGDFGDETGRITGHEG
IGIVKQVGEGVTSLKVGDRASVAWFFKGCGHCEYCVSGNETLCRNVENAGYTVDGAMAEE
CIVVADYSVKVPDGLDPAVASSITCAGVTTYKAVKVSQIQPGQWLAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLAFAKELGADMVINPKNEDAAKIIQEKVGGAHATVVTAVAKS
AFNSAVEAIRAGGRVVAVGLPPEKMDLSIPRLVLDGIEVLGSLVGTREDLKEAFQFAAEG
KVKPKVTKRKVEEINQIFDEMEHGKFTGRMVVDFTHH
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaaagcagccgtcataactaaagatcatacgatcgaagtgaaagacaccaaattacgc
cctctgaaatacggggaagcgcttttggaaatggaatattgcggggtatgtcataccgat
ctccacgtgaaaaacggggattttggcgatgaaaccggcagaattaccggccatgaaggc
atcggtatcgtcaagcaggtcggggaaggggttacttctctgaaagtcggtgaccgtgcc
agtgttgcatggttcttcaaaggctgcggccattgcgaatattgtgtcagtggaaatgaa
acgctttgccgcaacgttgaaaatgccggttatacggttgacggcgctatggcagaagaa
tgcatcgtcgttgccgattactcggtcaaagtgccagatggtcttgatcctgcggttgcc
agcagcatcacttgcgcgggtgtaaccacctataaagcagtcaaagtttctcagatacag
ccgggacaatggctggctatctatggcttgggcggtttaggcaatctagcccttcaatat
gccaagaatgttttcaacgccaaagtgatcgcgatcgatgtcaatgatgaacagctcgct
tttgccaaagagctgggcgcagatatggtcatcaatccgaaaaacgaagatgctgccaaa
atcattcaggaaaaagtcggcggcgcacatgcgacggtggtgacagctgttgccaaatcc
gcctttaactcggctgttgaggctatccgcgcgggtggccgtgttgtcgccgttggtctg
cctcctgaaaaaatggatttgagcattcctcgcttggtgcttgacggtatcgaagtctta
ggttctttggtcggaacgcgggaagatttgaaagaagccttccagtttgcagccgaaggt
aaggtcaaaccgaaagtcaccaagcgtaaagtcgaagaaatcaaccaaatctttgacgaa
atggaacatggtaaattcacaggccgtatggttgttgattttacccatcactag

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1596
Entry
ZMO1596           CDS       T00221                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00350  Tyrosine metabolism
zmo00620  Pyruvate metabolism
zmo00625  Chloroalkane and chloroalkene degradation
zmo00626  Naphthalene degradation
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1596
   00620 Pyruvate metabolism
    ZMO1596
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ZMO1596
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ZMO1596
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZMO1596
   00626 Naphthalene degradation
    ZMO1596
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZMO1596
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2
Other DBs
NCBI-ProteinID: AAV90220
UniProt: P0DJA2
Structure
PDB: 
3OX4 3OWO

Position
1634640..1635791
AA seq 383 aa
MASSTFYIPFVNEMGEGSLEKAIKDLNGSGFKNALIVSDAFMNKSGVVKQVADLLKAQGI
NSAVYDGVMPNPTVTAVLEGLKILKDNNSDFVISLGGGSPHDCAKAIALVATNGGEVKDY
EGIDKSKKPALPLMSINTTAGTASEMTRFCIITDEVRHVKMAIVDRHVTPMVSVNDPLLM
VGMPKGLTAATGMDALTHAFEAYSSTAATPITDACALKAASMIAKNLKTACDNGKDMPAR
EAMAYAQFLAGMAFNNASLGYVHAMAHQLGGYYNLPHGVCNAVLLPHVLAYNASVVAGRL
KDVGVAMGLDIANLGDKEGAEATIQAVRDLAASIGIPANLTELGAKKEDVPLLADHALKD
ACALTNPRQGDQKEVEELFLSAF
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggcttcttcaactttttatattcctttcgtcaacgaaatgggcgaaggttcgcttgaa
aaagcaatcaaggatcttaacggcagcggctttaaaaatgcgctgatcgtttctgatgct
ttcatgaacaaatccggtgttgtgaagcaggttgctgacctgttgaaagcacagggtatt
aattctgctgtttatgatggcgttatgccgaacccgactgttaccgcagttctggaaggc
cttaagatcctgaaggataacaattcagacttcgtcatctccctcggtggtggttctccc
catgactgcgccaaagccatcgctctggtcgcaaccaatggtggtgaagtcaaagactac
gaaggtatcgacaaatctaagaaacctgccctgcctttgatgtcaatcaacacgacggct
ggtacggcttctgaaatgacgcgtttctgcatcatcactgatgaagtccgtcacgttaag
atggccattgttgaccgtcacgttaccccgatggtttccgtcaacgatcctctgttgatg
gttggtatgccaaaaggcctgaccgccgccaccggtatggatgctctgacccacgcattt
gaagcttattcttcaacggcagctactccgatcaccgatgcttgcgctttgaaagcagct
tccatgatcgctaagaatctgaagaccgcttgcgacaacggtaaggatatgccggctcgt
gaagctatggcttatgcccaattcctcgctggtatggccttcaacaacgcttcgcttggt
tatgtccatgctatggctcaccagttgggcggttactacaacctgccgcatggtgtctgc
aacgctgttctgcttccgcatgttctggcttataacgcctctgtcgttgctggtcgtctg
aaagacgttggtgttgctatgggtctcgatatcgccaatctcggtgataaagaaggcgca
gaagccaccattcaggctgttcgcgatctggctgcttccattggtattccagcaaacctg
accgagctgggtgctaagaaagaagatgtgccgcttcttgctgaccacgctctgaaagat
gcttgtgctctgaccaacccgcgtcagggtgatcagaaagaagttgaagaactcttcctg
agcgctttctaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1722
Entry
ZMO1722           CDS       T00221                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00350  Tyrosine metabolism
zmo00620  Pyruvate metabolism
zmo00625  Chloroalkane and chloroalkene degradation
zmo00626  Naphthalene degradation
zmo00680  Methane metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1722
   00620 Pyruvate metabolism
    ZMO1722
  09102 Energy metabolism
   00680 Methane metabolism
    ZMO1722
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ZMO1722
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ZMO1722
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ZMO1722
   00626 Naphthalene degradation
    ZMO1722
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ZMO1722
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     ZMO1722
SSDB
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C TrkA_N 2-Hacid_dh_C HTH_38
Other DBs
NCBI-ProteinID: AAV90346
UniProt: Q5NLR4
Position
complement(1768329..1769438)
AA seq 369 aa
MKTRAAVAFAEKQPLEIVELDLEGPKDGEVLVEIMATGICHTDAYTLGGFDSEGIFPVVL
GHEGAGIVREVGKGVTSVKAGDHVIPLYTPECRQCKSCLSGKTNLCTAIRETQGRGVMPD
GTTRFSYKGQPIYHYMGCSTFSNFTVLPEIAVAKIREDAPFKAACYCGCGVSTGVGAVIN
TAKVEAGANVVVFGLGGIGLNVIQAARMVGADKIIGVDTNDSKAEWGRRFGMTDFVNPNK
IDEDIVPHLLRLTEGGADYTFDCTGNTDVMRQALEACHRGWGVSVVIGVAEAGKEISTRP
FQLVTGRVWKGSAFGGVKGRTGVPKIVDWYMKGKIEIDPMITHILSLEEINKAFDLMHEG
KSIRSVVLF
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaaacgcgtgctgctgttgcttttgccgaaaaacaacctttagaaattgtcgaactt
gacttggaaggccccaaagacggcgaagttttggttgaaattatggcgaccggtatttgt
catacggatgcctatactttgggcggattcgatagcgaaggcatctttccagttgtattg
gggcatgaaggtgctggtattgttcgcgaagtcgggaagggcgtgacttctgtcaaagcg
ggcgaccatgtcattccgctttacacgcctgaatgtcgccaatgtaaaagctgcctttct
ggtaaaaccaatctttgcacagctattcgtgaaacacagggtagaggtgtaatgccagat
ggcacaacacgcttttcttataaaggtcagcccatctatcactatatgggttgctcgact
ttctccaattttacggttttgccagaaatagccgttgccaaaattcgtgaagatgcgcct
tttaaagcggcatgttactgtggttgtggcgtttcaacaggggtcggggcagttatcaac
acggccaaagtggaagcgggtgccaatgttgtggtctttggtctcggtggaatcgggctt
aatgttatccaagccgcgagaatggtgggcgccgataaaattatcggtgttgataccaat
gactcaaaggctgaatgggggcggcgtttcgggatgacggattttgtcaatccgaacaag
attgatgaagatattgtgcctcatctgctgcgtttaacggaagggggcgctgattatacc
tttgattgcaccggtaataccgatgtcatgcgccaagccttggaagcctgtcatcgtgga
tggggtgtttcagtggtgatcggtgttgccgaggctggaaaagaaatttcaacccgtcct
ttccagttagtgacagggcgcgtttggaaaggctctgctttcggcggcgttaaaggcaga
accggtgttccgaaaatcgttgactggtatatgaagggtaaaattgaaattgatccgatg
attacccatatcctgtcattagaagagatcaataaagcgtttgacctgatgcatgagggt
aaatccattcgttcggttgttcttttctga

DBGET integrated database retrieval system