KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1240
Entry
ZMO1240           CDS       T00221                                 

Definition
(GenBank) phosphoglycerate mutase 1 family
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00260  Glycine, serine and threonine metabolism
zmo00680  Methane metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1240
  09102 Energy metabolism
   00680 Methane metabolism
    ZMO1240
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO1240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:zmo04131]
    ZMO1240
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO1240
Enzymes [BR:zmo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ZMO1240
Membrane trafficking [BR:zmo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ZMO1240
Exosome [BR:zmo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ZMO1240
  Exosomal proteins of melanoma cells
   ZMO1240
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: AAV89864
UniProt: P30798
Position
complement(1262549..1263235)
AA seq 228 aa
MPTLVLSRHGQSEWNLENRFTGWWDVNLTEQGVQEATAGGKALAEKGFEFDIAFTSVLTR
AIKTTNLILEAGKTLWVPTEKDWRLNERHYGGLTGLNKAETAAKHGEEQVHIWRRSYDVP
PPPMEKGSKFDLSGDRRYDGVKIPETESLKDTVARVLPYWEERIAPELKAGKRVLIGAHG
NSLRALVKHLSKLSDEEIVKFELPTGQPLVYELNDDLTPKDRYFLNER
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcccacgctcgttttgtcccgtcacggacagtccgaatggaaccttgaaaaccgtttc
accggttggtgggatgttaacctgactgaacagggtgttcaggaagcaacggccggtggt
aaagctctggctgaaaagggttttgaattcgatatcgctttcaccagcgttctgacccgc
gccatcaaaaccaccaatcttattctcgaagccggtaaaaccctttgggttccgaccgaa
aaagattggcgtttgaatgaacgtcactatggtggtctgaccggtctgaacaaggctgaa
accgccgctaaacatggtgaagaacaggttcatatttggcgccgttcttatgacgttccg
ccgcccccgatggaaaaaggcagcaagttcgatctgtctggcgatcgccgttatgatggt
gtcaagattcctgaaacggaaagcctgaaagacaccgttgctcgcgtgctgccttattgg
gaagaacgcattgcccctgaactgaaggctggcaagcgcgtcctgatcggtgcgcatggt
aactcactgcgcgctctcgttaagcatctgtcgaaattgtcggacgaagaaatcgtcaaa
ttcgaattgcccaccggtcagccgttggtctacgaattgaatgatgatctgactccgaaa
gatcgttacttccttaacgaacgttaa

DBGET integrated database retrieval system