KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1275
Entry
ZMO1275           CDS       T00221                                 

Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00260  Glycine, serine and threonine metabolism
zmo00290  Valine, leucine and isoleucine biosynthesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
Module
zmo_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZMO1275
   00290 Valine, leucine and isoleucine biosynthesis
    ZMO1275
Enzymes [BR:zmo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     ZMO1275
SSDB
Motif
Pfam: PALP ACT_4 ACT
Other DBs
NCBI-ProteinID: AAV89899
UniProt: Q5NN11
Position
1290193..1291431
AA seq 412 aa
MVSLDNPETLPVSLDDIKQAHQRIKNAIIRTPTLYSRTLSDLIGAGVWLKFENFQFTAAY
KERGALNKLLSLDKVARERGVIAASAGNHAQGLAYHGNRLDIPVTIVMPVHTPTVKVEQT
RGHGANIVLYGEQFDESLAHALELAEKDNLTFVHPFNDPAIIAGQGTVALEMLEDAPAID
TLVVPVGGGGLISGCAVVAKNADRPLDVIGAEAELYPSMYDYIKGKNLPCGGDTLAEGIA
VQVPGQLTRRFVEALVDDILLVSESNIEHALSLIVQIEKTIVEGAGAAGLGALLSHPERF
QGRQVGIIFSGGNIDTRLLANVLLRDLARSGRLARLRVRMKDQAGQLYKVARVFHDQQAN
IVEISYQRIFTTLPAKGLCADIECETRDQAHLRHLIDALREAGYGVTLIEPA
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggtaagcttggataatccagagactcttcccgtttcacttgatgatatcaaacaggcg
catcaacgcattaagaatgccattattagaaccccgaccctttacagtcggactttgtct
gacttgattggtgccggtgtctggctgaaatttgaaaatttccagtttaccgccgcctat
aaagaacggggtgcgttaaataaattattgtcgctggacaaggttgcccgcgaaagaggg
gttattgccgcttcggccggaaatcatgcccaaggtctcgcctatcacgggaatcgtttg
gatattccggtcacgatcgtgatgcctgtccataccccgacggtaaaagtcgagcagacc
cgtggacatggtgcgaatatcgtcctttatggcgaacaattcgatgaatcccttgcccat
gcgttagaattggctgaaaaagacaatctgacctttgtccatcctttcaatgatccagct
attattgccggtcagggcacggttgcccttgaaatgttggaagatgccccagcgattgac
actctggttgtgccagtgggtggcggcggcctgatttcaggctgtgctgtggttgccaaa
aacgcagatcggcctttggatgttattggtgccgaagccgagctttatccttcgatgtat
gattatatcaaagggaaaaatctgccttgcggtggggatactctggcagaagggatcgcg
gttcaggttcccgggcagttaactcgccgttttgttgaagccttggtcgatgatattttg
ctggtcagtgaaagcaatatcgaacatgctttgtctttgattgttcagattgaaaagacg
attgttgaaggggctggcgcggctggtttgggggcgttgctatcgcatcccgaacgattc
caaggcagacaggtaggcattatcttttctggcggtaatatcgacacccgcttgttagcc
aatgttctattgcgtgatttggcacgctctggtcgtctggcgcggttgcgggtcagaatg
aaagatcaagcaggtcagctttacaaagtagcgcgtgttttccacgatcagcaggcgaat
attgtcgaaatttcttatcagcgcatctttacaaccctgcccgctaagggattatgtgcc
gatattgaatgtgaaacgcgcgatcaggctcatttgcggcatttaatcgatgctttacgt
gaagcgggttatggtgtgaccttgattgaaccggcctga

DBGET integrated database retrieval system