KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1302
Entry
ZMO1302           CDS       T00221                                 

Definition
(GenBank) lipoate-protein ligase B
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00785  Lipoic acid metabolism
zmo01100  Metabolic pathways
zmo01240  Biosynthesis of cofactors
Module
zmo_M00881  Lipoic acid biosynthesis, plants and bacteria, octanoyl-ACP => dihydrolipoyl-E2/H
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    ZMO1302
Enzymes [BR:zmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     ZMO1302
SSDB
Motif
Pfam: CAT
Other DBs
NCBI-ProteinID: AAV89926
UniProt: Q5NMY4
Position
1317688..1318338
AA seq 216 aa
MSSIEWRVSEGLTDYEYARSEMTKRVADIANQEASEMLWFLQHPPLYTAGSSADRRELLM
PDRFPVYPAERGGRYTYHGPGQRIGYLMMDIRKHGNDIRRFVHSIEKWVIESLAEFGVTA
YSHPERIGIWVDTPDGEAKIGAIGIRVRRWISFHGFSLNICPDLEHFSGIIPCGISEFGV
TSLHALGKKVSMSDVDQALADRFPYFLEALQSKEAF
NT seq 651 nt   +upstreamnt  +downstreamnt
atgtcttctattgaatggcgggtcagtgaggggctgacagattacgaatatgcccgttca
gaaatgacgaaacgggtggcggatattgccaatcaggaagcctctgaaatgctgtggttt
ttgcagcatccgccgctttataccgccggaagtagtgcggataggcgggaattgttaatg
cctgatcgttttccggtttatcccgcggaacgtggggggcgttatacctatcatggcccc
ggtcagcggattggatatttaatgatggatatccgaaaacacggtaatgatattcgacgt
tttgttcattctattgaaaaatgggtgattgagagcctcgctgaatttggggtgacggcc
tatagtcatcctgaacggatcgggatttgggtcgatacgcctgacggcgaagctaaaatt
ggagcgattggtatccgagttcggcgttggattagttttcacggcttttctttaaatata
tgccctgatcttgagcatttttctggtattattccttgcggtatcagtgaattcggcgtg
accagccttcatgccttagggaaaaaggtgagtatgagcgacgtcgatcaggctttagcc
gatcgtttcccgtattttttagaagcattgcaatcaaaagaggctttctaa

DBGET integrated database retrieval system