KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1360
Entry
ZMO1360           CDS       T00221                                 

Definition
(GenBank) thiamine pyrophosphate protein TPP binding domain protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1360
Enzymes [BR:zmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     ZMO1360
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Other DBs
NCBI-ProteinID: AAV89984
UniProt: P06672
Structure
PDB: 

Position
complement(1373366..1375072)
AA seq 568 aa
MSYTVGTYLAERLVQIGLKHHFAVAGDYNLVLLDNLLLNKNMEQVYCCNELNCGFSAEGY
ARAKGAAAAVVTYSVGALSAFDAIGGAYAENLPVILISGAPNNNDHAAGHVLHHALGKTD
YHYQLEMAKNITAAAEAIYTPEEAPAKIDHVIKTALREKKPVYLEIACNIASMPCAAPGP
ASALFNDEASDEASLNAAVEETLKFIANRDKVAVLVGSKLRAAGAEEAAVKFADALGGAV
ATMAAAKSFFPEENPHYIGTSWGEVSYPGVEKTMKEADAVIALAPVFNDYSTTGWTDIPD
PKKLVLAEPRSVVVNGIRFPSVHLKDYLTRLAQKVSKKTGALDFFKSLNAGELKKAAPAD
PSAPLVNAEIARQVEALLTPNTTVIAETGDSWFNAQRMKLPNGARVEYEMQWGHIGWSVP
AAFGYAVGAPERRNILMVGDGSFQLTAQEVAQMVRLKLPVIIFLINNYGYTIEVMIHDGP
YNNIKNWDYAGLMEVFNGNGGYDSGAGKGLKAKTGGELAEAIKVALANTDGPTLIECFIG
REDCTEELVKWGKRVAAANSRKPVNKLL
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgagttatactgtcggtacctatttagcggagcggcttgtccagattggtctcaagcat
cacttcgcagtcgcgggcgactacaacctcgtccttcttgacaacctgcttttgaacaaa
aacatggagcaggtttattgctgtaacgaactgaactgcggtttcagtgcagaaggttat
gctcgtgccaaaggcgcagcagcagccgtcgttacctacagcgtcggtgcgctttccgca
tttgatgctatcggtggcgcctatgcagaaaaccttccggttatcctgatctccggtgct
ccgaacaacaatgatcacgctgctggtcacgtgttgcatcacgctcttggcaaaaccgac
tatcactatcagttggaaatggccaagaacatcacggccgccgctgaagcgatttacacc
ccggaagaagctccggctaaaatcgatcacgtgattaaaactgctcttcgtgagaagaag
ccggtttatctcgaaatcgcttgcaacattgcttccatgccctgcgccgctcctggaccg
gcaagcgcattgttcaatgacgaagccagcgacgaagcttctttgaatgcagcggttgaa
gaaaccctgaaattcatcgccaaccgcgacaaagttgccgtcctcgtcggcagcaagctg
cgcgcagctggtgctgaagaagctgctgtcaaatttgctgatgctctcggtggcgcagtt
gctaccatggctgctgcaaaaagcttcttcccagaagaaaacccgcattacatcggcacc
tcatggggtgaagtcagctatccgggcgttgaaaagacgatgaaagaagccgatgcggtt
atcgctctggctcctgtcttcaacgactactccaccactggttggacggatattcctgat
cctaagaaactggttctcgctgaaccgcgttctgtcgtcgttaacggcattcgcttcccc
agcgtccatctgaaagactatctgacccgtttggctcagaaagtttccaagaaaaccggt
gcattggacttcttcaaatccctcaatgcaggtgaactgaagaaagccgctccggctgat
ccgagtgctccgttggtcaacgcagaaatcgcccgtcaggtcgaagctcttctgaccccg
aacacgacggttattgctgaaaccggtgactcttggttcaatgctcagcgcatgaagctc
ccgaacggtgctcgcgttgaatatgaaatgcagtggggtcacattggttggtccgttcct
gccgccttcggttatgccgtcggtgctccggaacgtcgcaacatcctcatggttggtgat
ggttccttccagctgacggctcaggaagtcgctcagatggttcgcctgaaactgccggtt
atcatcttcttgatcaataactatggttacaccatcgaagttatgatccatgatggtccg
tacaacaacatcaagaactgggattatgccggtctgatggaagtgttcaacggtaacggt
ggttatgacagcggtgctggtaaaggcctgaaggctaaaaccggtggcgaactggcagaa
gctatcaaggttgctctggcaaacaccgacggcccaaccctgatcgaatgcttcatcggt
cgtgaagactgcactgaagaattggtcaaatggggtaagcgcgttgctgccgccaacagc
cgtaagcctgttaacaagctcctctag

DBGET integrated database retrieval system