KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1499
Entry
ZMO1499           CDS       T00221                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO1499
Enzymes [BR:zmo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     ZMO1499
SSDB
Motif
Pfam: PRA-PH MazG TetR_C_15
Other DBs
NCBI-ProteinID: AAV90123
UniProt: Q5NMD7
Position
complement(1525386..1525709)
AA seq 107 aa
MSEETLAYIESVIAERRKASPEDSYVSSLFHRGTAHIAQKVGEEAVETVIAALAQDKKSL
ESEAADLIFHLAVLLADRGSSFENVFSELRRREGVSGHAEKAARPKS
NT seq 324 nt   +upstreamnt  +downstreamnt
atgtctgaagaaacattagcctatatcgaatccgttattgctgaacggcgcaaagcctct
ccagaagattcctatgtttcttctctctttcatcgtggcactgcccatatcgcccagaaa
gtcggcgaagaagccgtagaaactgttattgcggccttggctcaagataaaaaatcactg
gagagtgaagcggctgatctcatttttcatctagctgttttattagctgaccgtggcagc
agctttgaaaatgtcttttcggaattaagacgacgtgaaggcgtctccggtcatgctgaa
aaagcggcacgaccaaaatcctaa

DBGET integrated database retrieval system