KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1500
Entry
ZMO1500           CDS       T00221                                 

Definition
(GenBank) imidazoleglycerol phosphate synthase, cyclase subunit
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO1500
Enzymes [BR:zmo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     ZMO1500
SSDB
Motif
Pfam: His_biosynth TMP-TENI ThiG NMO IMPDH Dus PcrB G3P_antiterm SBP_bac_3
Other DBs
NCBI-ProteinID: AAV90124
UniProt: Q5NMD6
Position
complement(1525814..1526581)
AA seq 255 aa
MTLCTRIIPCLDVADGRVVKGVNFTDLMDAGDPVEQAKVYDAAGADELCFLDISASHEGR
GTMLDVVARTAEVCFMPLTVGGGVRQVEDARALLLAGADKVAVNSAAVARPELVAEIADR
FGAQCVVAAIDARRNGDHWEVYTHGGRRPTGINALDHALNLTRLGAGEILLTSMDKDGTR
DGYDLELTRLVADSVPVPVIASGGVGNLDHMVEGVTKGHASALLAASIFHFGQYSLAEAH
EALAKAGLTVRHPPE
NT seq 768 nt   +upstreamnt  +downstreamnt
atgaccctttgtacccgaattatcccttgtctggatgttgccgatgggcgggtcgtgaaa
ggcgttaattttaccgatttaatggatgcaggcgatccagtcgaacaagccaaagtctat
gatgctgctggggctgacgaattatgctttctggacatttcggccagccatgaagggcgc
ggcactatgctggatgtcgtcgctcgtacggctgaagtctgttttatgcccctcacagtt
ggcggcggcgtacgtcaggttgaagatgctcgtgctttgctattagctggggctgacaaa
gtcgccgttaattccgctgctgtcgctcgaccagaattggtcgcagagattgctgaccgt
ttcggggcgcaatgtgtggttgctgccattgatgcccgtcgcaatggcgatcattgggaa
gtctatacccatggcggtcgtcgtccgacgggtatcaacgcgctcgatcatgcccttaat
ctgacgcgcttgggagcaggtgaaatccttctgacttccatggataaggacggtaccaga
gacggctatgatctggaattaacgcgtctggttgctgattctgtacccgttcctgttatt
gccagtggtggggttgggaatctcgatcatatggtcgaaggggtgaccaaaggtcatgcc
agcgcgttgctcgctgcctctatttttcattttggccaatatagcttggcagaagcccat
gaagccttggcaaaggctggattaaccgtgcggcatccgcccgaataa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1502
Entry
ZMO1502           CDS       T00221                                 

Definition
(GenBank) imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
  KO
K02501  imidazole glycerol-phosphate synthase subunit HisH [EC:4.3.2.10]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO1502
Enzymes [BR:zmo01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     ZMO1502
SSDB
Motif
Pfam: GATase SNO GATase_3 Peptidase_C26 DJ-1_PfpI
Other DBs
NCBI-ProteinID: AAV90126
UniProt: Q5NMD4
Position
complement(1527435..1528076)
AA seq 213 aa
MKNQASSTVALIDYGAGNLRSVANALLASGLARENLVVTANPDEVLQADRVVLPGVGAFA
SCMQALKAIPDMVPALEKAVLEKGRPFLGICVGMQLLADQGEEYGVHQGLGWIKGKVTPL
RPNDPSCKVPHMGWNQIGLTTDSHPLLRAGEAYFLHSYAFVPEDESTLLATTEHGGLVTA
AVGRDNIMGVQFHPEKSQSYGLEFLSRFLDWNP
NT seq 642 nt   +upstreamnt  +downstreamnt
gtgaaaaatcaggcatcttcaacagtcgctcttattgattacggtgcgggtaatctccgt
tcagttgccaatgcattattggcatcgggattagctcgcgaaaatctagttgttaccgcc
aatcccgatgaggttcttcaggcagaccgtgttgttttgccgggggtaggtgccttcgct
tcctgtatgcaggcgttaaaggctattcctgatatggtgcccgctttggaaaaggctgtt
cttgaaaaaggacggccttttttgggtatctgcgtcggcatgcagcttctcgctgaccaa
ggtgaagaatatggtgtccatcaaggtttgggttggatcaaaggcaaggtaacaccactc
cgcccgaatgatccttcttgtaaggtgcctcatatgggatggaaccagattgggctgacc
acagattcgcatcctcttcttcgggcgggtgaagcctattttctgcatagctacgctttt
gtgccagaagacgaatcgaccttattagcgacaactgaacatggcggtcttgtgacggcc
gcagtcggacgggataatattatgggtgtccaattccaccctgaaaaaagccagagctat
ggtctagagtttctgtcccgttttctggactggaatccctaa

DBGET integrated database retrieval system