KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1503
Entry
ZMO1503           CDS       T00221                                 

Definition
(GenBank) Imidazoleglycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO1503
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     ZMO1503
SSDB
Motif
Pfam: IGPD
Other DBs
NCBI-ProteinID: AAV90127
UniProt: Q5NMD3
Position
complement(1528078..1528698)
AA seq 206 aa
MKARVGYSDFMQRIASIHRQTAETDVHIHLNLDGHGQYNVKTGIGFFDHMLDQLFRHSLI
DCDVTVKGDLHIDPHHTIEDCALALGQAVQQALGDKAGITRFSHAYAPMDEALSRVAIDI
SGRPYLVWHSAFTQPRLGDLDTEMLEHWFLSFAQGAGLTLHVETLYGRNNHHIAESLFKA
LALALRQAVAIDAGKQGRIPSTKGSL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaaagcgcgggtaggctatagcgattttatgcagcgtatagcctcaatccatcgtcaa
accgccgaaaccgatgttcatatccatcttaatctggatggacatgggcaatataatgtc
aaaactggcattggtttctttgatcatatgttagatcagctttttcgccactcgcttatt
gattgcgatgtgaccgtcaaaggcgatctacatattgatccccatcatactatagaagat
tgtgcacttgctctcgggcaggctgttcagcaggctttgggtgacaaagcgggcattact
cgcttttctcacgcctatgcacctatggatgaagccttgagtcgggttgccattgatatt
tctggccgcccttatctggtttggcactccgctttcacccaaccacgcttgggtgatctt
gataccgaaatgctagaacattggtttctaagttttgctcaaggggcaggacttaccctt
catgttgaaacgctttatgggcgcaataaccatcatattgccgaaagcctgttcaaagcc
ttggctctagctttacgtcaggccgttgctattgatgcagggaagcaaggccgaatacct
tcgacaaagggtagtttgtaa

DBGET integrated database retrieval system