KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1550
Entry
ZMO1550           CDS       T00221                                 

Definition
(GenBank) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO1550
Enzymes [BR:zmo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     ZMO1550
SSDB
Motif
Pfam: HisG
Other DBs
NCBI-ProteinID: AAV90174
UniProt: Q9RH04
Position
1581752..1582420
AA seq 222 aa
MTKPLVFAIPKGRILKEALPMLEAAGIIPEPAFLDKESRLLRFKTNRPDIEIIRVRAFDV
ATFVAHGAAQMGIVGSDVIEEFSYPELYAPVDLDIGHCRLSIAEPKRLAKDDDPREWSHV
RVATKYPHLTHRHFEARGVQAECIKLNGAMEIAPALGLAGRIVDLVSSGRTLEENGLVEV
EKIMPISARLIVNRAAFKMRAGDIAPLVENFRRLVGVADNVA
NT seq 669 nt   +upstreamnt  +downstreamnt
atgactaaaccgcttgtctttgctatcccgaaaggtcgtattctgaaagaggcgcttcct
atgttggaagccgccggtatcattcctgagccggcctttctggataaagaaagccggttg
ctgcgcttcaaaacgaaccgccccgatatcgaaattattcgggttcgcgcctttgatgtt
gcaacctttgttgcgcatggggctgcccagatgggtattgtcggttccgatgttattgaa
gaattcagctatcccgagctttatgcgccagttgaccttgatatcggtcactgtcgtctt
tctatagcggagccgaaaaggcttgcgaaagatgatgacccacgggaatggagccatgtc
cgtgttgctaccaaatacccgcatttgacgcatcgacatttcgaggctcgcggggttcag
gctgagtgtattaagctcaatggtgcgatggaaatcgcccctgctctgggtcttgcgggc
cggattgtcgatctcgtctcgtcagggcgcaccttggaagaaaacgggttggttgaagtc
gaaaaaattatgccgatttccgctcgtctgattgtcaaccgtgccgcgttcaaaatgcgg
gcgggcgatattgcgcccttggttgaaaatttccgccgtttggtaggagttgcggataat
gttgcttaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1686
Entry
ZMO1686           CDS       T00221                                 

Definition
(GenBank) tRNA synthetase class II (G H P and S)
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00340  Histidine metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ZMO1686
SSDB
Motif
Pfam: tRNA-synt_His
Other DBs
NCBI-ProteinID: AAV90310
UniProt: Q5NLV0
Position
1732339..1733454
AA seq 371 aa
MTIAHGLLPEGLRDRLPPQAEAASRLLHHVIVAINRHGYERVSPPLAEFEESLLGRLKSA
RKQDLLRFVDPVSQRSLALRPDITGQIGRIATTRLNHRPRPLRLAYGGTVMKLRATQLRP
ERELMQAGAELIGNDSVAAVIEILGMAVETLKIAGVKEISIDLTLPDLVERLADTTLPID
ASKKEKLFAVLDAKDAGGLSELDATGYRPLLEAAGPFDEAIEKLQPMAEKLGFADRLEAL
KTIRASLDPSVHVTLDPTERHGFEYQTWIGFSLFGSGILGEIGRGGSYTIIHQDKREEQA
VGFSLYIDPLVDAGLGQKKSRKLFLPLGHDPEQARAFRQEGWITIAALDEEDDPVRHQCT
DILTGGHIKPL
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgacgatagcgcatggtttgctccccgaaggattacgagaccgccttccccctcaagct
gaagcagcttcccgcttgctgcatcatgttattgtagccatcaaccggcatggttatgaa
cgggtatccccgcctttagctgaattcgaagaaagtttgcttggccgtctaaaatcggca
cgcaagcaggatttgttgcgttttgttgaccctgtatcacaacgcagcttagcccttcgc
cctgatatcaccggacagataggccggattgcaacgacccgtttaaatcaccgtccgcgg
cctttacgtttggcttatggtggtacggtcatgaaattgcgggcaacccagctgcgcccc
gaacgggaattgatgcaggctggtgccgaattgatcggcaatgattccgttgctgccgtc
attgaaatattgggcatggccgttgaaacactgaaaattgccggtgtgaaagagatcagc
attgatctgactttgcctgatctggtcgaaagactggctgacacgaccttgccgatagac
gcttcaaagaaagagaaacttttcgctgtcttggatgccaaagatgcaggtggcctgagt
gagcttgatgcaacgggctatcggcctttgttagaagccgcaggaccttttgacgaggcg
attgaaaaattacagcccatggctgaaaaactgggttttgctgaccgcttggaagccttg
aaaactatccgtgcctcccttgatccgtcagttcatgtaacccttgatccgactgaacgg
catggtttcgaatatcaaacatggatcggcttttcgttattcggttccggtattctcggt
gaaattgggcgcggtggcagctataccatcattcatcaggataaacgcgaagagcaggcc
gtcggcttttctctttacatagatcctttggtcgatgccggtttggggcagaaaaaatcc
agaaaattgttcctgccgcttggccatgatccagaacaggctcgcgcttttcgtcaagaa
ggctggattacgattgccgcccttgatgaagaggatgaccctgtccgtcatcaatgcaca
gatattttaacaggcggtcatatcaagccgctttga

DBGET integrated database retrieval system