KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1605
Entry
ZMO1605           CDS       T00221                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00020  Citrate cycle (TCA cycle)
zmo00620  Pyruvate metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
Module
zmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1605
   00020 Citrate cycle (TCA cycle)
    ZMO1605
   00620 Pyruvate metabolism
    ZMO1605
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ZMO1605
SSDB
Motif
Pfam: Transket_pyr Transketolase_C Biotin_lipoyl Biotin_lipoyl_2 PFOR_II QRPTase_N T2SSB
Other DBs
NCBI-ProteinID: AAV90229
UniProt: O66113
Position
complement(1646308..1647696)
AA seq 462 aa
MAIELKMPALSPTMEEGTLTRWLVKEGDSIKAGEILAEIETDKAIMEFEAVDEGVITKIL
IPEGSENVKVGTAIAYLGTDANDVTLDGASAETKAEESAPVASPAKTEAAAVEEAATPSL
GKVINSAPEIPEGTEFFQQTLREALRDAMAEEMRRDDRVFVMGEEVAEYQGAYKVTQGLL
QEFGARRVVDTPISEYGFSGIGVGAAMEGLRPVIEFMTMNFSMQAIDHIINSAAKTHYMS
GGQVRCPIVFRGPNGAAPRVGAQHTQNFGPWYAAVPGLVVLAPYDAIDAKGLLKAAIRSD
DPVVFLECELLYGKTFDVPKMDDFVLPIGKARIIREGKDVTIVSYSIGVSFALTAAEALA
KEGIDAEVIDLRTLRPLDKETILQSLAKTNRIVTVEDGWPVCSISSEIAAIAMEEGFDNL
DAPVLRVTNADTPTPYAENLEKKGLVNPEAIIEAVRKVCYRK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggccatagagcttaaaatgcccgctctgtctccaacgatggaggaaggcacgctgacc
cgctggctggtaaaagaaggcgactccatcaaagctggtgaaattttggctgaaatcgaa
accgataaagccatcatggaatttgaagccgttgatgaaggcgtgataacgaaaatcctc
attcccgagggtagcgaaaatgtcaaagttggcaccgctatcgcttatcttgggacggat
gccaatgatgtgaccttggatggcgcctctgccgaaaccaaagcagaagaaagcgcccct
gttgcatcacctgccaaaacagaggccgcagcggttgaagaagcggcaacgccttcattg
ggtaaagtcattaattccgctcccgaaataccggaaggcaccgaattctttcagcagact
ttgcgcgaagccttacgcgatgccatggccgaagaaatgcggcgcgatgaccgtgttttt
gttatgggtgaagaagtcgctgaatatcagggtgcctataaagtcacgcaagggctgttg
caggaattcggtgcgcgtcgtgtcgtagatacgccgatttccgaatatggcttttccggt
attggtgtgggtgccgcaatggaaggtttgcgccctgtcatcgaattcatgaccatgaat
ttctcgatgcaggcgattgatcatatcatcaattctgcggccaaaacgcattatatgtcc
ggcggccaagtccgttgtcctatcgtcttccgtgggcccaatggggcagccccgcgcgtc
ggcgcacagcatacccagaatttcgggccttggtatgccgccgttcccggattggtcgtt
cttgcaccttatgatgctattgatgccaagggtttgttaaaagccgctatccgttccgat
gaccctgttgtctttttggaatgtgaactgctttacggcaagacttttgacgtgccaaaa
atggatgattttgttttacccattggtaaggcgcgcatcatccgtgaaggcaaggacgtc
acgattgtcagctattccattggtgtctcttttgcactgaccgctgccgaagctttagcc
aaagaaggcattgatgccgaagtaatcgaccttagaacgcttcgtccattggataaggaa
acgatccttcaaagtctggccaaaaccaatcggattgtgacggtagaagatggctggccg
gtttgctcgatttcttctgaaattgcggccattgccatggaagaaggcttcgacaatttg
gatgcccctgttttgcgggtaaccaatgccgatacgcccacaccttacgccgaaaatctc
gagaaaaaaggcttggtcaatcctgaagccattatcgaggccgtccgcaaggtctgctat
cgcaagtaa

KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1606
Entry
ZMO1606           CDS       T00221                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00020  Citrate cycle (TCA cycle)
zmo00620  Pyruvate metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
Module
zmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1606
   00020 Citrate cycle (TCA cycle)
    ZMO1606
   00620 Pyruvate metabolism
    ZMO1606
Enzymes [BR:zmo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     ZMO1606
SSDB
Motif
Pfam: E1_dh DXP_synthase_N FliX
Other DBs
NCBI-ProteinID: AAV90230
UniProt: O66112
Position
complement(1647698..1648762)
AA seq 354 aa
MAKATQDSNRPHKADVGSAIPNHDLPPIPGRYHADREELLEFYRRMLMIRRFEERCGQLY
GLGLIAGFCHLYIGQEAVAVGLQAALQPGRDSVITGYREHGHMLAYGIDPKIVMAELTGR
ASGISHGKGGSMHMFSTEHKFFGGNGIVGAQVPLGAGLAFAHKYRNDGGCSAAYFGDGSA
NQGQVYEAYNMAALWKLPVIFVIENNGYAMGTSIQRANAHTALSERGAGFGIPALVVDGM
DVLEVRGAATVAVDWVQAGKGPIILEMKTYRYRGHSMSDPARYRSREEVNDMKENHDPLD
NLKKDLFAAGVPEAELVKLDEDIRQQVKEAADFAEKAPLPADEELYTNILVGKY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggccaaagcaactcaggattccaatcggcctcataaagctgatgtcggatccgccatt
cccaatcacgatttgccaccgatacccggtcgctatcacgccgaccgggaagagctgcta
gaattttatcgacggatgctgatgatccgccgttttgaagaacggtgcggacagctttac
ggtttggggctgattgctggtttttgtcatctctatatcggtcaggaagccgttgcggtt
ggtctgcaagccgccctgcaaccgggacgggatagcgttattaccggctatcgcgaacat
gggcatatgctggcctatggtattgatcccaaaatcgttatggctgaattgacgggtcgt
gccagcggtatttcgcatggtaaaggcggctcgatgcatatgttctcgaccgaacataaa
tttttcggcggaaatggtatcgttggggctcaggtgccgcttggtgctggattggccttt
gcgcataaataccggaatgatgggggttgttctgcggcttatttcggtgatgggtcagcc
aatcagggacaggtttacgaagcctataacatggcggctttgtggaaattacccgtgatc
ttcgtcatcgaaaataacggttatgctatgggaaccagtatccaacgcgctaatgcccat
acggctttgtctgaaagaggcgcaggctttggtattccggctttggttgttgacggcatg
gatgtgcttgaagtcagaggcgctgctacagtcgcggttgactgggtgcaggctggaaaa
ggtcccatcatccttgaaatgaagacctatcgttatcggggacattctatgtctgatccg
gcgcgctatcgtagtcgcgaagaggtcaatgacatgaaggaaaaccacgatcctttagac
aatctgaaaaaagaccttttcgccgcaggcgttcccgaggccgagctggttaaactggat
gaagacatccgccagcaggtcaaagaggccgccgatttcgctgaaaaagcgcctttaccg
gctgatgaagaattatataccaatattctggtaggaaagtattga

DBGET integrated database retrieval system