KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1608
Entry
ZMO1608           CDS       T00221                                 

Definition
(GenBank) Phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00010  Glycolysis / Gluconeogenesis
zmo00680  Methane metabolism
zmo01100  Metabolic pathways
zmo01110  Biosynthesis of secondary metabolites
zmo01120  Microbial metabolism in diverse environments
zmo01200  Carbon metabolism
zmo01230  Biosynthesis of amino acids
zmo03018  RNA degradation
Module
zmo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ZMO1608
  09102 Energy metabolism
   00680 Methane metabolism
    ZMO1608
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    ZMO1608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:zmo03019]
    ZMO1608
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:zmo04147]
    ZMO1608
Enzymes [BR:zmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     ZMO1608
Messenger RNA biogenesis [BR:zmo03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ZMO1608
Exosome [BR:zmo04147]
 Exosomal proteins
  Proteins found in most exosomes
   ZMO1608
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-ProteinID: AAV90232
UniProt: P33675
Position
complement(1649538..1650827)
AA seq 429 aa
MTAIVSIHGRQVVDSRGNPTVEVDVTLEDGSFGRAAVPSGASTGVHEAVELRDGDKTRWG
GKGVTKAVHAVNNEIANAIIGLEAEDQELIDQTMIKLDGTPNKGKFGANAILGVSLAVAK
AAAEARGLPLYRYVGGTAAHVLPVPMMNIVNGGMHADNPIDFQEFMIAPVGASSINEAVR
IGTEVFHTLKKELSAKGMNTNVGDEGGFAPSLDSASSALDFIVDSISKAGYKPGEDVFIA
LDAASSEFYNKDQNIYDLKGEGRKLTSAQLVDYYVELCGKYPIYSIEDGLAEDDFEGWKI
LTEKLGDKVQLVGDDLFVTNVKRLSDGIERGIANSLLVKFNQIGSLSETLAAVNMANDAS
YTAVMSHRSGETEDTTIADLAVATNCGQIKTGSLCRSERIAKYNQLMRIEEELGSVAKYA
GRSVLRKAK
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgacagctattgtcagtatccatggccgtcaggttgtcgacagccgcggtaacccgacc
gttgaagttgatgttacgcttgaagatggcagcttcggccgcgccgcagtgccgtcaggt
gcttctaccggcgttcatgaagctgttgaacttcgtgatggcgacaaaacccgttggggt
ggtaaaggcgttaccaaagctgttcacgctgtaaacaacgaaattgctaacgcaattatt
ggtctggaagccgaagatcaggaactgatcgaccagacgatgatcaagctcgatggcacc
ccgaacaagggtaaattcggtgctaacgctatcctcggtgtcagcttggctgttgctaaa
gctgctgctgaagctcgcggtctcccgctttaccgttatgttggtggtacggcagctcac
gttcttccggttccgatgatgaacatcgttaacggtggtatgcacgctgacaaccccatc
gatttccaggaattcatgattgctccggttggcgccagctccatcaatgaagctgtccgc
atcggtaccgaagttttccataccctgaaaaaagaactgtctgctaaaggcatgaacacc
aacgtcggtgacgaaggtggtttcgctcctagccttgacagtgcttcttctgctctggac
ttcatcgtcgattccatctccaaagccggttataagccgggcgaagatgtgttcatcgct
ctcgatgcagcttcctccgagttctacaacaaagatcagaacatctacgatcttaagggt
gaaggccgtaaactgacctccgctcagctcgttgattactatgtcgaactctgcggcaaa
tatccgatctattccatcgaagatggtctggccgaagatgacttcgaaggctggaagatc
cttaccgaaaagctcggtgacaaagttcagttggtcggtgacgatctgttcgtgaccaac
gtgaagcgtctttctgatggtatcgaacgcggtatcgccaactcgctgctcgtgaagttt
aaccagatcggttctttgtctgaaacgctcgcagccgttaacatggctaacgacgcttct
tacacggctgttatgtctcaccgttccggtgaaaccgaagacaccacgattgctgacctc
gctgttgccaccaactgcggtcagatcaagaccggtagcctttgccgttccgaacgtatc
gctaaatacaatcagctgatgcgcatcgaagaagaactgggttcggttgctaaatatgct
ggccgttcggttcttagaaaagccaaataa

DBGET integrated database retrieval system