KEGG   Zymomonas mobilis subsp. mobilis ZM4: ZMO1724
Entry
ZMO1724           CDS       T00221                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
zmo  Zymomonas mobilis subsp. mobilis ZM4
Pathway
zmo00520  Amino sugar and nucleotide sugar metabolism
zmo00550  Peptidoglycan biosynthesis
zmo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:zmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ZMO1724
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ZMO1724
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
    ZMO1724
Enzymes [BR:zmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     ZMO1724
Peptidoglycan biosynthesis and degradation proteins [BR:zmo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   ZMO1724
SSDB
Motif
Pfam: EPSP_synthase
Other DBs
NCBI-ProteinID: AAV90348
UniProt: Q5NLR2
Position
complement(1770807..1772087)
AA seq 426 aa
MDRIKIRGGHRLKGRIPVSGAKNAVLALMPASLLTSDSLTLINLPRLADVDSCCHLLNEL
GVSTMVARSKGDHPGREITLTADTIASTVAPYDIVRKMRASILVLGPLLAREGEATVSLP
GGCAIGNRPIDLHLRALEALGAEIELTAGYVRARAPDGGLRGGIISFPVVSVGATENAIM
AAVLARGETVINNAAREPEIVDLCQCLMAMGAKIDGVGNSRLVIHGCDRLHGATHVVMPD
RIEAGSYACAAAITGGDVLLQGARSADMAEVLVELKESGLNISVEEDGIRVQADAPLKGL
TLSTAPFPGFPTDMQAQFMAMLALAQGTSVLTETIFENRYMHVPELVRMGADIQVKGRVA
VVKGVSGLVGAEVMATDLRASMSLIIAALAAEGETQVHRVYHLDRGYERLEEKLSAVGAD
IERVGG
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggatcgtatcaaaattcgcggtggccatcgcttgaaaggccgaattcctgtttccggc
gctaaaaatgccgttttggcgttaatgcctgccagtcttttaaccagtgactctttaacg
cttatcaatcttccgcgcctcgcggatgtggatagctgttgccatttgttgaatgaatta
ggcgtttcaacaatggtagctcggagtaagggagatcatcccgggcgtgaaattacgctg
acggcggatactatcgcttcgacggttgccccttatgatatcgttcgtaaaatgcgcgct
tcgattctcgttttggggcctttattggcaagagaaggcgaagcaacggtttcgctccca
ggcggctgtgctatcggtaaccgtcccattgatttacatcttcgggctttggaagctttg
ggtgccgaaattgagctgacggcgggatatgttcgggcaagagcgccggatggcggtctt
cgaggcggtatcatcagctttccggtggtttcggttggcgccactgaaaatgcgattatg
gcagcagtgttagcacgcggtgaaaccgtgattaataatgccgcacgcgaacctgaaatt
gtcgatctctgccaatgtcttatggccatgggtgctaaaattgacggtgtcggcaatagc
cgccttgtcattcatggttgtgaccgactgcatggggcgacccatgtggttatgcctgat
cgtatcgaggcaggtagttatgcctgtgccgcagctatcaccggtggcgatgtcttgttg
cagggtgccagatcagcggacatggccgaagttttggtcgaactgaaagaaagcggcctc
aatatttcggtggaagaagacggtatccgcgttcaggccgatgccccgttaaaaggccta
actttatcgacagcgcctttccccggttttccgaccgatatgcaggcacaatttatggcg
atgctggctttagctcagggcaccagtgttttgactgaaaccatctttgaaaatcgctat
atgcatgtgccagaactcgtcaggatgggtgccgatattcaggtaaaaggacgggtcgcc
gttgtaaaaggtgtctccggattggttggtgccgaagtgatggcgaccgatttgcgggct
tcgatgagcttgattatcgcagctctggccgccgaaggcgaaacgcaggttcaccgcgtt
tatcacctcgatcgtggctatgaacgtttagaagaaaaactatctgctgtcggtgctgat
atcgaacgtgtcggcggataa

DBGET integrated database retrieval system