KEGG   Zygosaccharomyces rouxii: ZYRO0F10054g
Entry
ZYRO0F10054g      CDS       T01118                                 

Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
zro  Zygosaccharomyces rouxii
Pathway
zro03440  Homologous recombination
zro03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:zro00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ZYRO0F10054g
   03450 Non-homologous end-joining
    ZYRO0F10054g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:zro03400]
    ZYRO0F10054g
DNA repair and recombination proteins [BR:zro03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     ZYRO0F10054g
   NHEJ (non-homologous end-joining)
    MRX complex
     ZYRO0F10054g
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-GeneID: 8205399
NCBI-ProteinID: XP_002497634
UniProt: C5DY40
Position
F:complement(814872..816854)
AA seq 660 aa
MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR
QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR
SDHSALEELGIEVLSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKVSG
HETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSLAIEAAGGKYSAVLS
VEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKTFTVQDVVEAILKDEVNSLKNGVIG
EVAKRPEAEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEES
KDPRKLEDPKEESKESKEVLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSLEETVEPT
LQVTEPPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTII
QVGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKY
GGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYDFPEPQPEAQSVPQ
VEAPGPNNLFVMDEDDSQDVALEEPEKPVLPSTSHLIDDRESDSDSDDDEPKFQFKRRKR
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgtggatcctcagataccagtatgatttggaagatggtaatttaaagcacgtctcttgc
tgtttaagacttggtgagacgtataacatcggcagatctagtaagaacctgttaaatata
aaaaatgataaaagtatatcgagacaacatgtaagtatttgctgggatggtaaggatcgt
caattgaaactgattaaccaaggtaagatgacagctgtttctgaaaagtatttaaaaatg
ggggaatctataagttttgggaaatcaatggggacggttttggtggaattgggcacaaaa
ccgttgaaaatgcaactgcagtggatggattctatttggatggtacctcagggaagtcga
tcagaccatagcgctttagaagaacttggcattgaagttttgtcatctgaattaagtagg
gccaatcttatagtgatagatgagcagcaaaattactctcgatggctttatggattagta
aagaggataccgctcatgaaccttgagtttttgaatgttgtgtcccagaaagtttctggt
catgaaaccgaattcgattcaatttggaccaagattatgaatgatggaagtcttcggtac
aaatcatgggaagttcaagctcaagtattgcagaatctagagtttttaactgttggtaag
gatgaagacacctcgttagctattgaagctgctggtggtaaatattcagcagttctgagt
gttgaagaattgcgagaagcagtgaaaaggaagggggatttgagtaacgttgtaatacta
aaaagtcatcttacaccagctgaggaattagcccccctgggcaagacttttaccgtgcag
gacgtggtggaagcgatactgaaagatgaggtgaattcattgaagaatggagtcattgga
gaggttgcgaagagacctgaagctgaagtcccaatggaaaagccagttaccaagaaacgt
aggttgaatagacctagagtcaaaccactagatattttgagtttctttgctggcggtgac
tccatgaaagaatctcagggagaatccaccatgaagttaaattcacaggaggaagaatcg
aaggatccaagaaagttagaagatccaaaggaagaatcaaaagaatctaaggaggtattg
caaccagaggtaccgaaggaatttaacgaatattcgaaggaagaacctgggcaaaagtcg
tatgaggaatcaaaggcagatgaaaatgaaaaatctctggaagaaacggtcgaaccaact
ctacaagtgacggaacctcctcctacgtctgccgctgaaaaaccaaataacgcccgccct
catagaaagccaactttaagtgattataggaaaggtgagagtccttcacaaaatgatatg
attcaaatgattcaagacaccaaaaaccatgaagttaagcgtctaaattccaccatcatt
caagttggtgatgaggagttgactgaggatgcgatcaatcagctgggtaatttagtgttg
gtggatcggaatgacaatttgatgcgtcgtagagatcgttcaccaactgtagatagccat
aatcctaactggaacaatcgtaagaattttaaaaatttcgttaaagtgtggcccaagtat
ggaggacaagatagtacaagtcgagaaggatcttcagatacaatccgcaaccgtgcattc
ctattgacgagacaatatgtgccgactaggacatatactagtggagactcttccaagcaa
gcacaagaagatctttacgatttcccagaaccacaaccagaggcacaatcggtaccgcaa
gtagaagctcctggtccgaacaatttatttgtgatggatgaagacgattcacaagacgta
gcactagaagaaccagaaaaacctgtccttccctcaacgtcgcatctaattgatgataga
gagagcgacagtgacagtgatgatgacgaacccaaattccagttcaagagaaggaaaaga
tag

DBGET integrated database retrieval system