supplemental

inferred list

DrugTargetPrediction<br> scoreInteraction type<br> [drug - target]
D06402, Sunitinib malate hsa:2324, (RefSeq) fms related receptor tyrosine kinase 41known
D03658, Dasatinib hsa:25, (RefSeq) ABL proto-oncogene 11known
D00293, Diazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha11known
D00329, Flurazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha11known
D00387, Triazolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha11known
D00550, Midazolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha11known
D01408, Flurazepam hydrochloride hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha11known
D00293, Diazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha21known
D00329, Flurazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha21known
D00387, Triazolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha21known
D00550, Midazolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha21known
D01408, Flurazepam hydrochloride hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha21known
D00293, Diazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha31known
D00329, Flurazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha31known
D00387, Triazolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha31known
D01408, Flurazepam hydrochloride hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha31known
D00293, Diazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha51known
D00329, Flurazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha51known
D00387, Triazolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha51known
D00550, Midazolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha51known
D01230, Flunitrazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha51known
D01408, Flurazepam hydrochloride hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha51known
D00293, Diazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha61known
D00329, Flurazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha61known
D00387, Triazolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha61known
D00550, Midazolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha61known
D01408, Flurazepam hydrochloride hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha61known
D00293, Diazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta11known
D00329, Flurazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta11known
D00387, Triazolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta11known
D01408, Flurazepam hydrochloride hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta11known
D00293, Diazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta21known
D00329, Flurazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta21known
D00387, Triazolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta21known
D01408, Flurazepam hydrochloride hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta21known
D00387, Triazolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta31known
D00293, Diazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma11known
D00329, Flurazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma11known
D00387, Triazolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma11known
D01408, Flurazepam hydrochloride hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma11known
D00293, Diazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma21known
D00329, Flurazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma21known
D00387, Triazolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma21known
D00550, Midazolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma21known
D01230, Flunitrazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma21known
D01408, Flurazepam hydrochloride hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma21known
D06402, Sunitinib malate hsa:3791, (RefSeq) kinase insert domain receptor1known
D08552, Sunitinib hsa:3791, (RefSeq) kinase insert domain receptor1known
D06402, Sunitinib malate hsa:3815, (RefSeq) KIT proto-oncogene1known
D06402, Sunitinib malate hsa:5159, (RefSeq) platelet derived growth factor receptor beta1known
D00904, Diclofenac sodium hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 21known
D01450, Bupivacaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 21known
D04048, Ropivacaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 21known
D01450, Bupivacaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 31known
D04048, Ropivacaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 31known
D03828, Pemetrexed disodium hsa:7298, (RefSeq) thymidylate synthetase1known
D06503, Pemetrexed sodium hydrate hsa:7298, (RefSeq) thymidylate synthetase1known
D00550, Midazolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9994known
D00387, Triazolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9992known
D01230, Flunitrazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9989known
D01408, Flurazepam hydrochloride hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9987known
D00550, Midazolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9985known
D00550, Midazolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9984known
D01230, Flunitrazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9983known
D07816, Diclofenac hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9976known
D01230, Flunitrazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9975known
D04048, Ropivacaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9975known
D00904, Diclofenac sodium hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9974known
D01230, Flunitrazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9972known
D01230, Flunitrazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.997known
D01408, Flurazepam hydrochloride hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9969known
D00370, Temazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9967known
D00550, Midazolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9964known
D00358, Lidocaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9956known
D02086, Lidocaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9955known
D01230, Flunitrazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9951known
D00293, Diazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9948known
D01230, Flunitrazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9947known
D00370, Temazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9943known
D04048, Ropivacaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9935known
D00387, Triazolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9934known
D00531, Nitrazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9931known
D01657, Lormetazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9931known
D00293, Diazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.993known
D08680, Vinorelbine hsa:10383, (RefSeq) tubulin beta 4B class IVb0.993known
D08490, Ropivacaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9929known
D00329, Flurazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9927known
D01293, Ethyl loflazepate hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9926known
D08552, Sunitinib hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.9923known
D00531, Nitrazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9923known
D01935, Vinorelbine tartrate hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9922known
D00370, Temazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9922known
D00370, Temazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9915known
D00370, Temazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9914known
D00370, Temazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9914known
D08127, Lidocaine hydrochloride monohydratehsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9913known
D01657, Lormetazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9912known
D01408, Flurazepam hydrochloride hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9911known
D00329, Flurazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.991known
D00370, Temazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9906known
D08680, Vinorelbine hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9906known
D08680, Vinorelbine hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9905known
D00531, Nitrazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9902known
D01657, Lormetazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9901known
D08680, Vinorelbine hsa:203068, (RefSeq) tubulin beta class I0.99known
D01935, Vinorelbine tartrate hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9898known
D01657, Lormetazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9897known
D01935, Vinorelbine tartrate hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9897known
D00370, Temazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9895known
D00531, Nitrazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9895known
D01935, Vinorelbine tartrate hsa:203068, (RefSeq) tubulin beta class I0.9893known
D08552, Sunitinib hsa:3815, (RefSeq) KIT proto-oncogene0.9892known
D01293, Ethyl loflazepate hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9891known
D00531, Nitrazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9888known
D01657, Lormetazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9888known
D00550, Midazolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9888known
D00358, Lidocaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9887known
D02086, Lidocaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9884known
D08680, Vinorelbine hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9883known
D07310, Amisulpride hsa:1813, (RefSeq) dopamine receptor D20.9882new - training
D01230, Flunitrazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.988known
D00531, Nitrazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.988known
D00370, Temazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9879known
D00293, Diazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9879known
D00531, Nitrazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9879known
D01935, Vinorelbine tartrate hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9876known
D05513, Piroxicam olamine hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9875known
D04882, Medazepam hydrochloride hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9875known
D01293, Ethyl loflazepate hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9874known
D01293, Ethyl loflazepate hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9873known
D01657, Lormetazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9871known
D07816, Diclofenac hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.987known
D00550, Midazolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.987known
D01293, Ethyl loflazepate hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.987known
D08552, Sunitinib hsa:2324, (RefSeq) fms related receptor tyrosine kinase 40.9866known
D08524, Sorafenib hsa:2322, (RefSeq) fms related receptor tyrosine kinase 30.9866known
D01293, Ethyl loflazepate hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9864known
D08490, Ropivacaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9863known
D01230, Flunitrazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9862known
D00531, Nitrazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9859known
D00531, Nitrazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9859known
D01450, Bupivacaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9859known
D08675, Vinblastine hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9857known
D00329, Flurazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9857known
D01293, Ethyl loflazepate hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9856known
D01293, Ethyl loflazepate hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9855known
D08680, Vinorelbine hsa:84617, (RefSeq) tubulin beta 6 class V0.9854known
D08127, Lidocaine hydrochloride monohydratehsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.985known
D01444, Bunitrolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.9849known
D00550, Midazolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9848known
D01935, Vinorelbine tartrate hsa:84617, (RefSeq) tubulin beta 6 class V0.9846known
D00387, Triazolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.984known
D00694, Clorazepate dipotassium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9839known
D06678, Motesanib hsa:2321, (RefSeq) fms related receptor tyrosine kinase 10.9839known
D04882, Medazepam hydrochloride hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9839known
D01292, Medazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9837known
D01287, Levobupivacaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9836known
D01657, Lormetazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9836known
D00713, Thiamylal sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9834known
D00695, Flurazepam hydrochloride hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9833known
D08675, Vinblastine hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9833known
D01657, Lormetazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9833known
D08675, Vinblastine hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9832known
D07472, Pemetrexed hsa:7298, (RefSeq) thymidylate synthetase0.9829known
D00694, Clorazepate dipotassium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9828known
D01293, Ethyl loflazepate hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9828known
D00464, Oxazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9828new - training
D08675, Vinblastine hsa:203068, (RefSeq) tubulin beta class I0.9828known
D00370, Temazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9824known
D04882, Medazepam hydrochloride hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9822known
D04882, Medazepam hydrochloride hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9822known
D08394, Pirmenol hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9821known
D01408, Flurazepam hydrochloride hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.982known
D00387, Triazolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9819known
D00694, Clorazepate dipotassium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9818known
D04882, Medazepam hydrochloride hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9818known
D06414, Dasatinib hsa:25, (RefSeq) ABL proto-oncogene 10.9816known
D01657, Lormetazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9815known
D01292, Medazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9814known
D00695, Flurazepam hydrochloride hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9812known
D08675, Vinblastine hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9811known
D04882, Medazepam hydrochloride hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9811known
D00694, Clorazepate dipotassium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.981known
D00370, Temazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9806known
D00464, Oxazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9805new - training
D00553, Prilocaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.9805known
D01068, Vinblastine sulfate hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9805known
D00694, Clorazepate dipotassium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9805known
D01450, Bupivacaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9805known
D04882, Medazepam hydrochloride hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9804known
D04882, Medazepam hydrochloride hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9803known
D00713, Thiamylal sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9801known
D01230, Flunitrazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.98known
D00464, Oxazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.98new - training
D06304, Vindesine hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9799known
D01408, Flurazepam hydrochloride hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9799known
D00464, Oxazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9796new - training
D01292, Medazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9794known
D08680, Vinorelbine hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9794known
D00695, Flurazepam hydrochloride hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9791known
D01292, Medazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9786known
D01935, Vinorelbine tartrate hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9786known
D00531, Nitrazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9785known
D01292, Medazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9785known
D01292, Medazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9784known
D00695, Flurazepam hydrochloride hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9784known
D00293, Diazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9784known
D00713, Thiamylal sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9783known
D00713, Thiamylal sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9783known
D01354, Fludiazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9783known
D00695, Flurazepam hydrochloride hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9783known
D08675, Vinblastine hsa:84617, (RefSeq) tubulin beta 6 class V0.9782known
D00695, Flurazepam hydrochloride hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9782known
D01293, Ethyl loflazepate hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9781known
D01068, Vinblastine sulfate hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9781known
D00713, Thiamylal sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.978known
D01068, Vinblastine sulfate hsa:347733, (RefSeq) tubulin beta 2B class IIb0.978known
D01292, Medazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9779known
D00694, Clorazepate dipotassium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9778known
D00695, Flurazepam hydrochloride hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9778known
D00694, Clorazepate dipotassium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9777known
D00694, Clorazepate dipotassium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9777known
D04882, Medazepam hydrochloride hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9776known
D01068, Vinblastine sulfate hsa:203068, (RefSeq) tubulin beta class I0.9775known
D06304, Vindesine hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9775known
D00713, Thiamylal sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9774known
D06304, Vindesine hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9774known
D01287, Levobupivacaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9773known
D01354, Fludiazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9772known
D06304, Vindesine hsa:203068, (RefSeq) tubulin beta class I0.977known
D00531, Nitrazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9768known
D00713, Thiamylal sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9767known
D01292, Medazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9765known
D00713, Thiamylal sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9765known
D00464, Oxazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9764new - training
D01293, Ethyl loflazepate hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9764known
D00695, Flurazepam hydrochloride hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9763known
D07538, Bosentan hsa:1909, (RefSeq) endothelin receptor type A0.9762known
D00293, Diazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9762known
D01354, Fludiazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9762known
D08283, Nordazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9761known
D00329, Flurazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.976known
D01068, Vinblastine sulfate hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9759known
D00694, Clorazepate dipotassium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9757known
D01354, Fludiazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9754known
D09760, Ibuprofen sodium hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9754known
D06304, Vindesine hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9754known
D00387, Triazolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9753known
D08283, Nordazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9753known
D01292, Medazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9751known
D00695, Flurazepam hydrochloride hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.975known
D01354, Fludiazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9749known
D00638, Flecainide acetate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9746known
D08216, Mianserin hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.9746known
D07784, Delorazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9745known
D02252, Amobarbital sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9742known
D06272, Sorafenib tosylate hsa:2322, (RefSeq) fms related receptor tyrosine kinase 30.9741known
D00638, Flecainide acetate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.974known
D00329, Flurazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9739known
D00713, Thiamylal sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9739known
D01657, Lormetazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9738known
D07784, Delorazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9737known
D02252, Amobarbital sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9737known
D01408, Flurazepam hydrochloride hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9735known
D08283, Nordazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9733known
D00370, Temazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9732known
D00358, Lidocaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9732known
D04882, Medazepam hydrochloride hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9731known
D01068, Vinblastine sulfate hsa:84617, (RefSeq) tubulin beta 6 class V0.973known
D08059, Ibuprofen sodiumhsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9727known
D00738, Mepivacaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9727known
D00550, Midazolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9726known
D08283, Nordazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9726known
D09760, Ibuprofen sodium hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9726known
D07784, Delorazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9725known
D02086, Lidocaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9725known
D06304, Vindesine hsa:84617, (RefSeq) tubulin beta 6 class V0.9724known
D01657, Lormetazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9723known
D08675, Vinblastine hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9722known
D01657, Lormetazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9722known
D02252, Amobarbital sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9722known
D01354, Fludiazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9721known
D01354, Fludiazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9721known
D01354, Fludiazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.972known
D08283, Nordazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9718known
D07784, Delorazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9717known
D00531, Nitrazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9715known
D08490, Ropivacaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9715known
D04882, Medazepam hydrochloride hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9714known
D02252, Amobarbital sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9713known
D07784, Delorazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9711known
D01230, Flunitrazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9711known
D08283, Nordazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9709known
D08283, Nordazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9708known
D02252, Amobarbital sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9708known
D06106, Thiamylalhsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9708known
D00618, Nisoldipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9707known
D07552, Bupivacaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9707new - training
D00550, Midazolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9704known
D06106, Thiamylalhsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9704known
D01810, Nicorandil hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.9704known
D08127, Lidocaine hydrochloride monohydratehsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9704known
D08356, Phenobarbital diethylaminehsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9701known
D00293, Diazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.97known
D01354, Fludiazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9699known
D00358, Lidocaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9699known
D08947, Motesanib diphosphate hsa:2321, (RefSeq) fms related receptor tyrosine kinase 10.9696known
D01292, Medazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9695known
D05512, Piroxicam cinnamate hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9694known
D00555, Amobarbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9693known
D02086, Lidocaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9692known
D00713, Thiamylal sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9691known
D08283, Nordazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9691known
D00695, Flurazepam hydrochloride hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.969known
D01230, Flunitrazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.969known
D08283, Nordazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9688known
D07784, Delorazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9687known
D07784, Delorazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9685known
D08059, Ibuprofen sodiumhsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9685known
D02252, Amobarbital sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9685known
D07784, Delorazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9684known
D02252, Amobarbital sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9684known
D01293, Ethyl loflazepate hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9684known
D00694, Clorazepate dipotassium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9684known
D06106, Thiamylalhsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9683known
D00808, Suramin hexasodium hsa:6262, (RefSeq) ryanodine receptor 20.9682known
D02252, Amobarbital sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9681known
D06106, Thiamylalhsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.968known
D01292, Medazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9678known
D07517, Benzydamine salicylatehsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9677known
D00808, Suramin hexasodium hsa:6263, (RefSeq) ryanodine receptor 30.9677known
D00618, Nisoldipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9676known
D08356, Phenobarbital diethylaminehsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9675known
D05513, Piroxicam olamine hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9675known
D00329, Flurazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9675known
D08108, Lapatinib hsa:1956, (RefSeq) epidermal growth factor receptor0.9674known
D00464, Oxazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9674new - training
D01769, Vindesine sulfate hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9674known
D06106, Thiamylalhsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9674known
D00713, Thiamylal sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9674known
D00695, Flurazepam hydrochloride hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9673known
D01740, Barbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9673known
D00365, Lorazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9673known
D00617, Nicardipine hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9672known
D01068, Vinblastine sulfate hsa:347688, (RefSeq) tubulin beta 8 class VIII0.967known
D01740, Barbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.967known
D00365, Lorazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.967known
D00694, Clorazepate dipotassium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9668known
D08270, Nicardipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9668known
D08490, Ropivacaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9667known
D07784, Delorazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9666known
D06304, Vindesine hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9665known
D02252, Amobarbital sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9664known
D02914, Amlodipine maleate hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9662known
D08127, Lidocaine hydrochloride monohydratehsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9661known
D06106, Thiamylalhsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9659known
D06106, Thiamylalhsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9658known
D00555, Amobarbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9657known
D00387, Triazolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9656known
D08386, Pirarubicin hydrochloridehsa:7155, (RefSeq) DNA topoisomerase II beta0.9655known
D08356, Phenobarbital diethylaminehsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9655known
D00370, Temazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9655known
D08386, Pirarubicin hydrochloridehsa:7153, (RefSeq) DNA topoisomerase II alpha0.9654known
D00618, Nisoldipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9654known
D01451, Scopolamine butylbromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9654known
D00365, Lorazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9653known
D00738, Mepivacaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9652known
D01769, Vindesine sulfate hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9651known
D01740, Barbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.965known
D08356, Phenobarbital diethylaminehsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.965known
D08356, Phenobarbital diethylaminehsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9649known
D01769, Vindesine sulfate hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9649known
D08356, Phenobarbital diethylaminehsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9649known
D07552, Bupivacaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9646new - training
D01769, Vindesine sulfate hsa:203068, (RefSeq) tubulin beta class I0.9645known
D00365, Lorazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9645known
D06106, Thiamylalhsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9643known
D00555, Amobarbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9643known
D00555, Amobarbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9643known
D08356, Phenobarbital diethylaminehsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9642known
D00617, Nicardipine hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9642known
D01740, Barbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9642known
D06106, Thiamylalhsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9641known
D00550, Midazolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.964known
D00365, Lorazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.964known
D01408, Flurazepam hydrochloride hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9638known
D00280, Clonazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9637known
D08270, Nicardipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9637known
D00555, Amobarbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9637known
D01740, Barbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9636known
D00370, Temazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9636known
D00694, Clorazepate dipotassium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9632known
D02914, Amlodipine maleate hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9632known
D04882, Medazepam hydrochloride hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9632known
D01354, Fludiazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9631known
D00555, Amobarbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9631known
D08356, Phenobarbital diethylaminehsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9631known
D01769, Vindesine sulfate hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9629known
D00464, Oxazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9626new - training
D00346, Isoniazid hsa:4129, (RefSeq) monoamine oxidase B0.9625known
D01287, Levobupivacaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9625known
D01230, Flunitrazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9625known
D00280, Clonazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9625known
D00555, Amobarbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9624known
D00531, Nitrazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9623known
D00555, Amobarbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9623known
D01740, Barbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9622known
D00464, Oxazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9622new - training
D00311, Estazolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9621known
D01740, Barbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9621known
D00617, Nicardipine hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.962known
D08283, Nordazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9619known
D00365, Lorazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9619known
D00365, Lorazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9618known
D00464, Oxazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9618new - training
D01293, Ethyl loflazepate hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9617known
D08270, Nicardipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9615known
D01354, Fludiazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9615known
D08356, Phenobarbital diethylaminehsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9614known
D00365, Lorazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9611known
D02914, Amlodipine maleate hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.961known
D00311, Estazolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.961known
D01740, Barbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9609known
D00695, Flurazepam hydrochloride hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9607known
D03562, Clorazepate monopotassium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9607known
D01292, Medazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9606known
D00280, Clonazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9606known
D00430, Secobarbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9605known
D07450, Amlodipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9605known
D00293, Diazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9604known
D01475, Flurbiprofen axetil hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9602known
D01740, Barbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9602known
D00464, Oxazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9601new - training
D00531, Nitrazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9601known
D01769, Vindesine sulfate hsa:84617, (RefSeq) tubulin beta 6 class V0.96known
D08394, Pirmenol hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.96known
D00365, Lorazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.96known
D08283, Nordazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9599known
D07517, Benzydamine salicylatehsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9599known
D00280, Clonazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9598known
D00740, Procaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9598known
D01293, Ethyl loflazepate hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9596known
D00713, Thiamylal sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9596known
D00555, Amobarbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9596known
D02252, Amobarbital sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9594known
D07784, Delorazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9594known
D00808, Suramin hexasodium hsa:6261, (RefSeq) ryanodine receptor 10.9593known
D00280, Clonazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9593known
D03562, Clorazepate monopotassium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.959known
D00311, Estazolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.959known
D01908, Nilvadipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9589known
D00618, Nisoldipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9588known
D01287, Levobupivacaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9586known
D00280, Clonazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9585known
D00280, Clonazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9584known
D00430, Secobarbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9584known
D00311, Estazolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9582known
D01657, Lormetazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.958known
D00329, Flurazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9578known
D02252, Amobarbital sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9577known
D04048, Ropivacaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9577known
D01310, Secobarbital sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9577known
D07784, Delorazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9576known
D00311, Estazolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9576known
D01354, Fludiazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9575known
D07450, Amlodipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9573known
D00457, Quazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9571known
D00370, Temazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9571known
D03562, Clorazepate monopotassium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.957known
D00311, Estazolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.957known
D00311, Estazolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.957known
D04882, Medazepam hydrochloride hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9567known
D00280, Clonazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9567known
D08680, Vinorelbine hsa:81027, (RefSeq) tubulin beta 1 class VI0.9565known
D00280, Clonazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9565known
D06106, Thiamylalhsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9564known
D00430, Secobarbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9564known
D03562, Clorazepate monopotassium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9563known
D08356, Phenobarbital diethylaminehsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.956known
D01007, Propiverine hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.956known
D01908, Nilvadipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9558known
D08680, Vinorelbine hsa:10381, (RefSeq) tubulin beta 3 class III0.9558known
D01935, Vinorelbine tartrate hsa:81027, (RefSeq) tubulin beta 1 class VI0.9558known
D01310, Secobarbital sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9558known
D01657, Lormetazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9558known
D00457, Quazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9557known
D00430, Secobarbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9557known
D08062, Idarubicin hsa:7155, (RefSeq) DNA topoisomerase II beta0.9557known
D03562, Clorazepate monopotassium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9557known
D08394, Pirmenol hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9556known
D08062, Idarubicin hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9556known
D03562, Clorazepate monopotassium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9556known
D03562, Clorazepate monopotassium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9555known
D00555, Amobarbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9554known
D00617, Nicardipine hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9554known
D00430, Secobarbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9554known
D00430, Secobarbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9554known
D07450, Amlodipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9553known
D00499, Pentobarbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9552known
D01475, Flurbiprofen axetil hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9552known
D00311, Estazolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9551known
D01935, Vinorelbine tartrate hsa:10381, (RefSeq) tubulin beta 3 class III0.955known
D08270, Nicardipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.955known
D00430, Secobarbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9549known
D00311, Estazolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9549known
D06106, Thiamylalhsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9549known
D00499, Pentobarbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9548known
D08283, Nordazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9548known
D08394, Pirmenol hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9547known
D04882, Medazepam hydrochloride hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9546known
D00550, Midazolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9545known
D02914, Amlodipine maleate hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9544known
D07993, Fosphenytoin hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9543known
D01268, Cloxazolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9542known
D00740, Procaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9542known
D08356, Phenobarbital diethylaminehsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9542known
D05512, Piroxicam cinnamate hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9541known
D01769, Vindesine sulfate hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9541known
D07784, Delorazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.954known
D00642, Quinidine gluconate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.954known
D00531, Nitrazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9538known
D01310, Secobarbital sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9538known
D00555, Amobarbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9537known
D01268, Cloxazolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9537known
D02252, Amobarbital sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9537known
D03562, Clorazepate monopotassium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9537known
D00457, Quazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9536known
D01908, Nilvadipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9536known
D04024, Lapatinib ditosylate hsa:1956, (RefSeq) epidermal growth factor receptor0.9536known
D00430, Secobarbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9535known
D08394, Pirmenol hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9535known
D01293, Ethyl loflazepate hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9533known
D01740, Barbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9532known
D01451, Scopolamine butylbromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9531known
D01310, Secobarbital sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9531known
D00713, Thiamylal sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.953known
D03562, Clorazepate monopotassium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9529known
D01292, Medazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9529known
D00457, Quazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9529known
D00499, Pentobarbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9529known
D00695, Flurazepam hydrochloride hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9528known
D00365, Lorazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9528known
D01230, Flunitrazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9527known
D01451, Scopolamine butylbromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9527known
D01593, Nimetazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9527known
D01310, Secobarbital sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9525known
D01310, Secobarbital sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9525known
D00694, Clorazepate dipotassium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9523known
D01310, Secobarbital sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9523known
D00457, Quazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9523known
D00464, Oxazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9523new - training
D00430, Secobarbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9523known
D00457, Quazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9522known
D00457, Quazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9522known
D00629, Nitrendipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9521known
D00499, Pentobarbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9521known
D00638, Flecainide acetate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9521known
D01268, Cloxazolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9517known
D00506, Phenobarbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9517known
D00499, Pentobarbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9516known
D01740, Barbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9515known
D00365, Lorazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9513known
D08422, Procaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9513new - training
D01292, Medazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.951known
D01268, Cloxazolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.951known
D00127, Piroxicam hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.951known
D00464, Oxazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9509new - training
D00713, Thiamylal sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9508known
D00551, Tetracaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9508known
D00695, Flurazepam hydrochloride hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9507known
D01310, Secobarbital sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9507known
D07552, Bupivacaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9507new - training
D06106, Thiamylalhsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9505known
D01268, Cloxazolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9503known
D00499, Pentobarbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9503known
D01593, Nimetazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9503known
D00506, Phenobarbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9503known
D00457, Quazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9502known
D00499, Pentobarbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9502known
D00694, Clorazepate dipotassium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9501known
D00319, Felodipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.95known
D00714, Thiopental sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9499known
D05028, Midazolam maleate hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9498known
D01310, Secobarbital sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9497known
D01657, Lormetazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9496known
D01007, Propiverine hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9496known
D00457, Quazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9496known
D08675, Vinblastine hsa:81027, (RefSeq) tubulin beta 1 class VI0.9495known
D00280, Clonazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9494known
D00500, Pentobarbital sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9492known
D01268, Cloxazolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9492known
D01268, Cloxazolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9492known
D00629, Nitrendipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.949known
D08675, Vinblastine hsa:10381, (RefSeq) tubulin beta 3 class III0.9488known
D00499, Pentobarbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9488known
D00738, Mepivacaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9487known
D07450, Amlodipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9486known
D00500, Pentobarbital sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9485known
D00499, Pentobarbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9483known
D00506, Phenobarbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9483known
D04882, Medazepam hydrochloride hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9482known
D01593, Nimetazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9482known
D00311, Estazolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.948known
D01593, Nimetazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9479known
D01593, Nimetazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9479known
D00714, Thiopental sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9478known
D06517, Pirmenol hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9477known
D01593, Nimetazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9477known
D00280, Clonazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9477known
D00506, Phenobarbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9476known
D01268, Cloxazolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9476known
D00693, Chlordiazepoxide hydrochloride hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9476known
D00370, Temazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9475known
D02197, Vincristine sulfate hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9474known
D00714, Thiopental sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9474known
D01908, Nilvadipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9472known
D08356, Phenobarbital diethylaminehsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9472known
D01268, Cloxazolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9472known
D01593, Nimetazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.947known
D00714, Thiopental sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.947known
D00506, Phenobarbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.947known
D00319, Felodipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9469known
D00738, Mepivacaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9469known
D00365, Lorazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9469known
D00629, Nitrendipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9469known
D03562, Clorazepate monopotassium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9468known
D00506, Phenobarbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9467known
D00714, Thiopental sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9466known
D01354, Fludiazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9466known
D01740, Barbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9466known
D00430, Secobarbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9466known
D00506, Phenobarbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9465known
D00500, Pentobarbital sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9465known
D00311, Estazolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9464known
D00693, Chlordiazepoxide hydrochloride hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9462known
D00438, Nimodipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9462known
D05028, Midazolam maleate hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.946known
D07552, Bupivacaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9459new - training
D00500, Pentobarbital sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9459known
D00638, Flecainide acetate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9459known
D01593, Nimetazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9458known
D08422, Procaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9457new - training
D00437, Nifedipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9455known
D08283, Nordazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9455known
D00555, Amobarbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9454known
D00500, Pentobarbital sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9454known
D00126, Ibuprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9453known
D00470, Prazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9452known
D05028, Midazolam maleate hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9451known
D02197, Vincristine sulfate hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9451known
D08679, Vincristine hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9451known
D03562, Clorazepate monopotassium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.945known
D05028, Midazolam maleate hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.945known
D02197, Vincristine sulfate hsa:347733, (RefSeq) tubulin beta 2B class IIb0.945known
D00319, Felodipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9449known
D00430, Secobarbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9448known
D01354, Fludiazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9447known
D00506, Phenobarbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9446known
D02197, Vincristine sulfate hsa:203068, (RefSeq) tubulin beta class I0.9446known
D00713, Thiamylal sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9446known
D01279, Flutoprazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9445known
D01292, Medazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9445known
D07817, Diclofenac diethylaminehsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9445known
D00695, Flurazepam hydrochloride hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9445known
D01068, Vinblastine sulfate hsa:81027, (RefSeq) tubulin beta 1 class VI0.9445known
D00531, Nitrazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9443known
D00500, Pentobarbital sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9443known
D00693, Chlordiazepoxide hydrochloride hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9443known
D00506, Phenobarbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9443known
D01593, Nimetazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9442known
D00500, Pentobarbital sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9442known
D02272, Quinidine sulfate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9442known
D00470, Prazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.944known
D00694, Clorazepate dipotassium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.944known
D06304, Vindesine hsa:81027, (RefSeq) tubulin beta 1 class VI0.944known
D05028, Midazolam maleate hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9439known
D01450, Bupivacaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9439known
D01293, Ethyl loflazepate hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9439known
D00714, Thiopental sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9439known
D05028, Midazolam maleate hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9438known
D01068, Vinblastine sulfate hsa:10381, (RefSeq) tubulin beta 3 class III0.9438known
D01310, Secobarbital sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9438known
D08283, Nordazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9436known
D00693, Chlordiazepoxide hydrochloride hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9436known
D07817, Diclofenac diethylaminehsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9436known
D05028, Midazolam maleate hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9434known
D01279, Flutoprazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9434known
D00438, Nimodipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9433known
D07784, Delorazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9433known
D02252, Amobarbital sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9432known
D06304, Vindesine hsa:10381, (RefSeq) tubulin beta 3 class III0.9432known
D00457, Quazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9431known
D05028, Midazolam maleate hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9431known
D02197, Vincristine sulfate hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9431known
D00693, Chlordiazepoxide hydrochloride hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.943known
D00740, Procaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9429known
D08679, Vincristine hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9428known
D08679, Vincristine hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9427known
D00500, Pentobarbital sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9426known
D00696, Midazolam hydrochloride hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9425known
D00437, Nifedipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9425known
D07962, Flecainide hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9425known
D00693, Chlordiazepoxide hydrochloride hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9424known
D01007, Propiverine hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9424known
D00693, Chlordiazepoxide hydrochloride hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9424known
D00500, Pentobarbital sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9424known
D00280, Clonazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9423known
D08679, Vincristine hsa:203068, (RefSeq) tubulin beta class I0.9423known
D01310, Secobarbital sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.942known
D00470, Prazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.942known
D07962, Flecainide hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9418known
D02103, Phenytoin sodium hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9418known
D00714, Thiopental sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9417known
D00714, Thiopental sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9415known
D00457, Quazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9415known
D01279, Flutoprazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9414known
D00470, Prazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9414known
D07784, Delorazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9413known
D00499, Pentobarbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9413known
D02252, Amobarbital sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9412known
D00696, Midazolam hydrochloride hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9412known
D00438, Nimodipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9411known
D06106, Thiamylalhsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9411known
D00311, Estazolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9408known
D00706, Zolpidem tartrate hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9408known
D01264, Daunorubicin hydrochloride hsa:7155, (RefSeq) DNA topoisomerase II beta0.9408known
D00470, Prazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9408known
D08058, Ibuprofen arginine salthsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9408known
D02579, Iproniazid hsa:4129, (RefSeq) monoamine oxidase B0.9407known
D08679, Vincristine hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9407known
D01264, Daunorubicin hydrochloride hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9407known
D01279, Flutoprazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9407known
D00693, Chlordiazepoxide hydrochloride hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9407known
D06606, Ibuprofen lysine hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9406known
D01451, Scopolamine butylbromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9405known
D00638, Flecainide acetate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9405known
D00629, Nitrendipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9404known
D00437, Nifedipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9404known
D01268, Cloxazolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9404known
D00470, Prazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9403known
D00693, Chlordiazepoxide hydrochloride hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9403known
D00470, Prazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9403known
D02197, Vincristine sulfate hsa:84617, (RefSeq) tubulin beta 6 class V0.9402known
D01657, Lormetazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9402known
D01279, Flutoprazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9402known
D05028, Midazolam maleate hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.94known
D02096, Fosphenytoin sodium hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9399known
D08356, Phenobarbital diethylaminehsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9399known
D00714, Thiopental sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9398known
D00499, Pentobarbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9398known
D01104, Barnidipine hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9395known
D01279, Flutoprazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9395known
D01279, Flutoprazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9394known
D00696, Midazolam hydrochloride hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9393known
D00706, Zolpidem tartrate hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9392known
D00555, Amobarbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9391known
D01554, Pilsicainide hydrochloride hydrate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9391known
D01593, Nimetazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9391known
D08181, Mepivacaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9389new - training
D04882, Medazepam hydrochloride hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9389known
D03562, Clorazepate monopotassium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9388known
D06106, Thiamylalhsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9388known
D01326, Aprindine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9387known
D01268, Cloxazolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9386known
D00696, Midazolam hydrochloride hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9385known
D00470, Prazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9384known
D00319, Felodipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9383known
D01354, Fludiazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9382known
D06606, Ibuprofen lysine hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9382known
D00430, Secobarbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9382known
D00470, Prazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.938known
D08679, Vincristine hsa:84617, (RefSeq) tubulin beta 6 class V0.9379known
D08356, Phenobarbital diethylaminehsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9379known
D00696, Midazolam hydrochloride hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9379known
D00564, Warfarin sodium hsa:79001, (RefSeq) vitamin K epoxide reductase complex subunit 10.9379known
D00506, Phenobarbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9377known
D08058, Ibuprofen arginine salthsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9376known
D01279, Flutoprazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9375known
D00464, Oxazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9375new - training
D00696, Midazolam hydrochloride hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9375known
D01279, Flutoprazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9375known
D00696, Midazolam hydrochloride hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9374known
D01593, Nimetazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9373known
D08283, Nordazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9373known
D00706, Zolpidem tartrate hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9372known
D00512, Phenytoin hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9372known
D00555, Amobarbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9371known
D01740, Barbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9371known
D00365, Lorazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9369known
D08377, Pilsicainide hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9368known
D00706, Zolpidem tartrate hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9366known
D01104, Barnidipine hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9365known
D01007, Propiverine hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9362known
D00706, Zolpidem tartrate hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9359known
D08070, Imipramine hsa:6532, (RefSeq) solute carrier family 6 member 40.9359known
D05028, Midazolam maleate hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9358known
D00706, Zolpidem tartrate hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9358known
D00706, Zolpidem tartrate hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9357known
D01885, Pirarubicin hsa:7155, (RefSeq) DNA topoisomerase II beta0.9357known
D01885, Pirarubicin hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9357known
D00457, Quazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9357known
D00696, Midazolam hydrochloride hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9356known
D02086, Lidocaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9356known
D00506, Phenobarbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9356known
D01310, Secobarbital sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9356known
D00358, Lidocaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9354known
D00551, Tetracaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9354known
D00815, Imipramine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.9354known
D00126, Ibuprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9354known
D00696, Midazolam hydrochloride hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9353known
D00464, Oxazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9352new - training
D00713, Thiamylal sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9352known
D00552, Benzocaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9352known
D00695, Flurazepam hydrochloride hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9352known
D01292, Medazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9351known
D00500, Pentobarbital sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9351known
D01740, Barbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9351known
D07784, Delorazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.935known
D02252, Amobarbital sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.935known
D00365, Lorazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9349known
D00499, Pentobarbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9348known
D00438, Nimodipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9348known
D00694, Clorazepate dipotassium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9347known
D02197, Vincristine sulfate hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9345known
D08181, Mepivacaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9344new - training
D05028, Midazolam maleate hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9344known
D01104, Barnidipine hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9344known
D07494, Barnidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9341known
D08422, Procaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9341new - training
D00706, Zolpidem tartrate hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.934known
D00437, Nifedipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.934known
D02045, Benidipine hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9339known
D03899, Doxorubicin hsa:7155, (RefSeq) DNA topoisomerase II beta0.9337known
D03899, Doxorubicin hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9337known
D00280, Clonazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9336known
D00693, Chlordiazepoxide hydrochloride hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9335known
D01268, Cloxazolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9335known
D00500, Pentobarbital sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9335known
D00740, Procaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9334known
D00740, Procaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.9334known
D00706, Zolpidem tartrate hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9333known
D03814, Atropine methylbromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9332known
D07901, Epirubicin hsa:7155, (RefSeq) DNA topoisomerase II beta0.9329known
D10017, Naproxen etemesil hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9329known
D07901, Epirubicin hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9328known
D00789, Chlorpromazine hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9328known
D07993, Fosphenytoin hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9328known
D06106, Thiamylalhsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9326known
D08394, Pirmenol hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.9325known
D00714, Thiopental sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9324known
D00642, Quinidine gluconate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9324known
D00113, Atropine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9322known
D02069, Atropine sulfate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9322known
D08679, Vincristine hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9322known
D00311, Estazolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9321known
D04985, Methohexital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9321new - training
D08490, Ropivacaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9319known
D00693, Chlordiazepoxide hydrochloride hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9319known
D01769, Vindesine sulfate hsa:81027, (RefSeq) tubulin beta 1 class VI0.9319known
D03814, Atropine methylbromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9317known
D00280, Clonazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9316known
D08104, Ketorolac hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9316known
D08356, Phenobarbital diethylaminehsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9315known
D00470, Prazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9315known
D00732, Chloroprocaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9313known
D02069, Atropine sulfate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9313known
D02069, Atropine sulfate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9312known
D01769, Vindesine sulfate hsa:10381, (RefSeq) tubulin beta 3 class III0.9312known
D07494, Barnidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9311known
D02045, Benidipine hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.931known
D00555, Amobarbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9309known
D01173, Cilnidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9308known
D01279, Flutoprazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9308known
D00714, Thiopental sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9308known
D03562, Clorazepate monopotassium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9307known
D03814, Atropine methylbromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9307known
D00430, Secobarbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9304known
D01593, Nimetazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9303known
D08127, Lidocaine hydrochloride monohydratehsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9303known
D00506, Phenobarbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9303known
D00714, Thiopental sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9302known
D00311, Estazolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9301known
D00470, Prazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9298known
D00677, Granisetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.9298known
D00642, Quinidine gluconate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9292known
D00464, Oxazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9291new - training
D07993, Fosphenytoin hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9291known
D08458, Quinidine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.929known
D08104, Ketorolac hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.929known
D07494, Barnidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.929known
D00552, Benzocaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.929known
D01279, Flutoprazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9289known
D01740, Barbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9289known
D02045, Benidipine hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9289known
D04985, Methohexital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9289new - training
D03562, Clorazepate monopotassium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9288known
D01354, Fludiazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9288known
D00500, Pentobarbital sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9288known
D00365, Lorazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9287known
D00696, Midazolam hydrochloride hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9287known
D02229, Sildenafil citrate hsa:8654, (RefSeq) phosphodiesterase 5A0.9286known
D00430, Secobarbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9285known
D01077, Methylatropine nitrate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9284known
D07579, Aspirin calcium salthsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9283known
D07993, Fosphenytoin hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9283known
D00147, Hyoscyamine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9282known
D00642, Quinidine gluconate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9282known
D00136, Haloperidol hsa:1813, (RefSeq) dopamine receptor D20.9282known
D00903, Diclofenac potassium hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9282known
D01939, Ziprasidone hydrochloride hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.9281known
D01104, Barnidipine hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9279known
D01173, Cilnidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9279known
D05333, Paclitaxel poliglumex hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9279known
D04479, Hyoscyamine hydrobromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9279known
D08283, Nordazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9278known
D01310, Secobarbital sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9276known
D07582, Aspirin sodiumhsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9276known
D04490, Ibuprofen aluminum hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9276known
D07581, Aspirin magnesium salthsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9276known
D01455, Cifenline succinate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9275known
D04479, Hyoscyamine hydrobromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9274known
D00457, Quazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9273known
D02100, Ziprasidone mesylate hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.9273known
D04985, Methohexital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9271new - training
D00706, Zolpidem tartrate hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.927known
D00141, Indomethacin hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9269known
D04985, Methohexital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9269new - training
D01077, Methylatropine nitrate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9269known
D00696, Midazolam hydrochloride hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9268known
D01227, Bosentan hsa:1909, (RefSeq) endothelin receptor type A0.9268known
D05028, Midazolam maleate hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9267known
D04985, Methohexital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9266new - training
D01514, Etizolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9266known
D07993, Fosphenytoin hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9265known
D01564, Rilmazafone hydrochloride hydrate hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9265known
D00693, Chlordiazepoxide hydrochloride hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9264known
D06517, Pirmenol hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9264known
D01514, Etizolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.926known
D00147, Hyoscyamine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9259known
D00141, Indomethacin hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9259known
D00637, Disopyramide phosphate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9258known
D01310, Secobarbital sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9258known
D05181, Aspirin aluminum hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9258known
D01173, Cilnidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9257known
D07784, Delorazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9257known
D00642, Quinidine gluconate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9256known
D02252, Amobarbital sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9256known
D00903, Diclofenac potassium hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9256known
D05333, Paclitaxel poliglumex hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9256known
D04985, Methohexital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9256new - training
D00280, Clonazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9256known
D00499, Pentobarbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9255known
D05333, Paclitaxel poliglumex hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9255known
D01564, Rilmazafone hydrochloride hydrate hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9253known
D00706, Zolpidem tartrate hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9253known
D04985, Methohexital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9253new - training
D02214, Epirubicin hydrochloride hsa:7155, (RefSeq) DNA topoisomerase II beta0.9253known
D02214, Epirubicin hydrochloride hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9253known
D00457, Quazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9252known
D00732, Chloroprocaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9252known
D02098, Proparacaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9251known
D05333, Paclitaxel poliglumex hsa:203068, (RefSeq) tubulin beta class I0.9251known
D04490, Ibuprofen aluminum hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9251known
D00113, Atropine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.925known
D08422, Procaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9247new - training
D04479, Hyoscyamine hydrobromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9247known
D00225, Alprazolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9247known
D04985, Methohexital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9246new - training
D01648, Hyoscyamine methylbromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9245known
D01268, Cloxazolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9244known
D07920, Estriol succinatehsa:2099, (RefSeq) estrogen receptor 10.9244known
D01564, Rilmazafone hydrochloride hydrate hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9244known
D00720, Mepenzolate bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9243known
D00551, Tetracaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9242known
D00470, Prazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9242known
D01077, Methylatropine nitrate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9241known
D05343, Palonosetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.924known
D00311, Estazolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.924known
D01514, Etizolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.924known
D01564, Rilmazafone hydrochloride hydrate hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9238known
D08121, Levomethadone hsa:2903, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2A0.9238known
D00225, Alprazolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9238known
D01287, Levobupivacaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9237known
D06106, Thiamylalhsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9236known
D05333, Paclitaxel poliglumex hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9236known
D01279, Flutoprazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9235known
D00499, Pentobarbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9235known
D07920, Estriol succinatehsa:2100, (RefSeq) estrogen receptor 20.9234known
D02002, Isoniazid sodium methanesulfonate hydrate hsa:4129, (RefSeq) monoamine oxidase B0.9234known
D01514, Etizolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9233known
D01564, Rilmazafone hydrochloride hydrate hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9233known
D01593, Nimetazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9232known
D00720, Mepenzolate bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9231known
D00375, Mephenytoin hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.923known
D02272, Quinidine sulfate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9229known
D08181, Mepivacaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9228new - training
D00720, Mepenzolate bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9228known
D07494, Barnidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9228known
D07175, Palonosetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.9228known
D04985, Methohexital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9227new - training
D01514, Etizolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9227known
D04657, Lacidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9226known
D02045, Benidipine hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9226known
D01268, Cloxazolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9225known
D03562, Clorazepate monopotassium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9225known
D00430, Secobarbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9224known
D08121, Levomethadone hsa:2905, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2C0.9224known
D06517, Pirmenol hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9224known
D08356, Phenobarbital diethylaminehsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9223known
D07509, Benidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9221known
D01648, Hyoscyamine methylbromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.922known
D00113, Atropine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9219known
D01514, Etizolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9218known
D00225, Alprazolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9218known
D01514, Etizolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9217known
D00506, Phenobarbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9217known
D01648, Hyoscyamine methylbromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9217known
D06517, Pirmenol hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9216known
D01451, Scopolamine butylbromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.9216known
D00555, Amobarbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9216known
D00696, Midazolam hydrochloride hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9214known
D01372, Zopiclone hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9213known
D07595, Fosphenytoin sodium hydrate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9212known
D01593, Nimetazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9212known
D01372, Zopiclone hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9212known
D00225, Alprazolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9211known
D01454, Bupranolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.921known
D05028, Midazolam maleate hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9209known
D07962, Flecainide hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9209known
D05333, Paclitaxel poliglumex hsa:84617, (RefSeq) tubulin beta 6 class V0.9208known
D01564, Rilmazafone hydrochloride hydrate hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9206known
D01564, Rilmazafone hydrochloride hydrate hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9205known
D02103, Phenytoin sodium hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9205known
D00225, Alprazolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9205known
D07886, Efonidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9205known
D01564, Rilmazafone hydrochloride hydrate hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9205known
D08854, Amrubicin hsa:7155, (RefSeq) DNA topoisomerase II beta0.9202known
D08854, Amrubicin hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9202known
D01326, Aprindine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9201known
D01514, Etizolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9201known
D06517, Pirmenol hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.92known
D00506, Phenobarbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9199known
D01514, Etizolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9199known
D00500, Pentobarbital sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9198known
D00225, Alprazolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9198known
D00464, Oxazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9198new - training
D00225, Alprazolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9197known
D00147, Hyoscyamine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9197known
D04657, Lacidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9197known
D07579, Aspirin calcium salthsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9197known
D00125, Etoposide hsa:7155, (RefSeq) DNA topoisomerase II beta0.9196known
D07516, Benzydamine hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9196known
D01310, Secobarbital sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9196known
D00706, Zolpidem tartrate hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9196known
D01740, Barbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9196known
D00125, Etoposide hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9196known
D00365, Lorazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9195known
D01173, Cilnidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9195known
D08103, Ketoprofen sodiumhsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9195known
D02272, Quinidine sulfate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9194known
D00457, Quazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9193known
D00789, Chlorpromazine hydrochloride hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.9193known
D01372, Zopiclone hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9192known
D07509, Benidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9191known
D03814, Atropine methylbromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9191known
D08459, Quinidine phenylethylbarbituratehsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9189known
D07582, Aspirin sodiumhsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9188known
D02098, Proparacaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9188known
D00621, Enalapril maleate hsa:1636, (RefSeq) angiotensin I converting enzyme0.9188known
D08524, Sorafenib hsa:3815, (RefSeq) KIT proto-oncogene0.9188known
D04985, Methohexital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9188new - training
D07819, Diclofenac calciumhsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9188known
D07581, Aspirin magnesium salthsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9187known
D05028, Midazolam maleate hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9186known
D02096, Fosphenytoin sodium hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9186known
D01564, Rilmazafone hydrochloride hydrate hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9186known
D02272, Quinidine sulfate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9186known
D01372, Zopiclone hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9185known
D08422, Procaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.9185new - training
D02069, Atropine sulfate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9185known
D01007, Propiverine hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.9184known
D01898, Haloperidol decanoate hsa:1813, (RefSeq) dopamine receptor D20.9184known
D00109, Aspirin hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9183known
D07516, Benzydamine hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9182known
D00693, Chlordiazepoxide hydrochloride hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.918known
D00225, Alprazolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9179known
D01372, Zopiclone hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9179known
D00225, Alprazolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9179known
D08181, Mepivacaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9178new - training
D00500, Pentobarbital sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9177known
D04985, Methohexital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9176new - training
D04657, Lacidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9176known
D08377, Pilsicainide hsa:3741, (RefSeq) potassium voltage-gated channel subfamily A member 50.9176known
D07886, Efonidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9175known
D00499, Pentobarbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9173known
D00714, Thiopental sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9173known
D00158, Tolmetin sodium hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9171known
D05181, Aspirin aluminum hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9171known
D07509, Benidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.917known
D02103, Phenytoin sodium hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9168known
D00127, Piroxicam hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9168known
D01554, Pilsicainide hydrochloride hydrate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9166known
D01372, Zopiclone hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9165known
D01372, Zopiclone hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9164known
D01268, Cloxazolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9164known
D00280, Clonazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9164known
D00638, Flecainide acetate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.9164known
D01326, Aprindine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9163known
D00458, Quetiapine fumarate hsa:148, (RefSeq) adrenoceptor alpha 1A0.9163known
D02756, Aclarubicin hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9162known
D08394, Pirmenol hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9161known
D02756, Aclarubicin hsa:7155, (RefSeq) DNA topoisomerase II beta0.9161known
D00512, Phenytoin hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.916known
D00693, Chlordiazepoxide hydrochloride hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.916known
D02103, Phenytoin sodium hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.916known
D07443, Amfenac hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.916known
D08121, Levomethadone hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.916known
D00470, Prazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9159known
D08511, Setiptiline hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.9156known
D07477, Atropine oxide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9155known
D01071, Hexobarbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9154known
D07477, Atropine oxide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9153known
D00738, Mepivacaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9153known
D01372, Zopiclone hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9153known
D00714, Thiopental sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9153known
D01071, Hexobarbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9152known
D00147, Hyoscyamine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9152known
D05333, Paclitaxel poliglumex hsa:347688, (RefSeq) tubulin beta 8 class VIII0.9151known
D02096, Fosphenytoin sodium hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9151known
D04479, Hyoscyamine hydrobromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9151known
D01328, Clotiazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.915known
D01593, Nimetazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.915known
D00763, Mivacurium chloride hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.915known
D01316, Mexazolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.915known
D01279, Flutoprazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9149known
D00552, Benzocaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9149known
D07443, Amfenac hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9149known
D07962, Flecainide hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9148known
D01326, Aprindine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9148known
D02272, Quinidine sulfate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9148known
D00311, Estazolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9147known
D01372, Zopiclone hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9147known
D07477, Atropine oxide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9145known
D08481, Rilmazafone hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9145known
D07886, Efonidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9144known
D08377, Pilsicainide hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9144known
D02096, Fosphenytoin sodium hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9142known
D01316, Mexazolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9141known
D07819, Diclofenac calciumhsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.914known
D03274, Chlorpromazine hibenzate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.914known
D01077, Methylatropine nitrate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.914known
D02103, Phenytoin sodium hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.914known
D03011, Atropine oxide hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9139known
D00470, Prazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9138known
D00346, Isoniazid hsa:4128, (RefSeq) monoamine oxidase A0.9138known
D03011, Atropine oxide hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9138known
D00506, Phenobarbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9138known
D08950, Neratinib hsa:1956, (RefSeq) epidermal growth factor receptor0.9138known
D02096, Fosphenytoin sodium hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9137known
D01122, Ibuprofen piconol hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9136known
D08102, Ketoprofen lysinehsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9135known
D01328, Clotiazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9135known
D07886, Efonidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9135known
D00700, Mephobarbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9135known
D01613, Azasetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.9134known
D08103, Ketoprofen sodiumhsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9134known
D01071, Hexobarbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9133known
D00677, Granisetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.9132known
D03562, Clorazepate monopotassium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9132known
D08481, Rilmazafone hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9132known
D00430, Secobarbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9131known
D01514, Etizolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9131known
D01279, Flutoprazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9131known
D03011, Atropine oxide hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.913known
D01316, Mexazolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.913known
D00113, Atropine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.913known
D00696, Midazolam hydrochloride hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.913known
D00216, Acarbose hsa:2548, (RefSeq) alpha glucosidase0.9128known
D02197, Vincristine sulfate hsa:81027, (RefSeq) tubulin beta 1 class VI0.9127known
D05028, Midazolam maleate hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9127known
D01071, Hexobarbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9126known
D00512, Phenytoin hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9125known
D01316, Mexazolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9123known
D01071, Hexobarbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9121known
D00158, Tolmetin sodium hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.912known
D02197, Vincristine sulfate hsa:10381, (RefSeq) tubulin beta 3 class III0.912known
D00700, Mephobarbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9119known
D01564, Rilmazafone hydrochloride hydrate hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9119known
D01744, Brotizolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9118known
D01316, Mexazolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9118known
D00893, Pravastatin sodium hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.9118known
D00551, Tetracaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9118known
D00500, Pentobarbital sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9117known
D00512, Phenytoin hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9116known
D01554, Pilsicainide hydrochloride hydrate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9116known
D01328, Clotiazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9115known
D00700, Mephobarbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9115known
D00706, Zolpidem tartrate hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9115known
D00109, Aspirin hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9115known
D01514, Etizolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9115known
D04657, Lacidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9114known
D08481, Rilmazafone hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9113known
D01744, Brotizolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9112known
D00225, Alprazolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9111known
D00615, Amlodipine besylate hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9111known
D00732, Chloroprocaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9111known
D00696, Midazolam hydrochloride hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.911known
D01328, Clotiazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9109known
D00720, Mepenzolate bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9108known
D00700, Mephobarbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9108known
D02624, Eszopiclone hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9108known
D00733, Dibucaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9107known
D07509, Benidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.9107known
D00552, Benzocaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9107known
D01207, Omeprazole sodium hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.9106known
D01071, Hexobarbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9106known
D07552, Bupivacaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9106new - training
D08481, Rilmazafone hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9106known
D01071, Hexobarbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9105known
D08679, Vincristine hsa:81027, (RefSeq) tubulin beta 1 class VI0.9104known
D01310, Secobarbital sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9104known
D02110, Indomethacin sodium hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9104known
D08122, Levomethadone hydrochloridehsa:2903, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2A0.9103known
D02110, Indomethacin sodium hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9103known
D01275, Doxorubicin hydrochloride hsa:7155, (RefSeq) DNA topoisomerase II beta0.9103known
D01564, Rilmazafone hydrochloride hydrate hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9103known
D01328, Clotiazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9102known
D00700, Mephobarbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9102known
D01207, Omeprazole sodium hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.9102known
D01275, Doxorubicin hydrochloride hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9102known
D01328, Clotiazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9101known
D01328, Clotiazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9101known
D08102, Ketoprofen lysinehsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9101known
D00132, Ketoprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9101known
D00457, Quazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9101known
D00693, Chlordiazepoxide hydrochloride hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.91known
D08481, Rilmazafone hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.91known
D00512, Phenytoin hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9099known
D08048, Hydroquinidine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9099known
D00216, Acarbose hsa:8972, (RefSeq) maltase-glucoamylase GAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVV0.9099known
D01648, Hyoscyamine methylbromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9097known
D07918, Estradiol hemihydratehsa:2099, (RefSeq) estrogen receptor 10.9097known
D08679, Vincristine hsa:10381, (RefSeq) tubulin beta 3 class III0.9097known
D02624, Eszopiclone hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9097known
D08481, Rilmazafone hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9096known
D00132, Ketoprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9096known
D08481, Rilmazafone hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9095known
D00706, Zolpidem tartrate hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9095known
D01554, Pilsicainide hydrochloride hydrate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9095known
D01071, Hexobarbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9094known
D08377, Pilsicainide hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9094known
D01316, Mexazolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9094known
D01744, Brotizolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9093known
D00225, Alprazolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9093known
D01316, Mexazolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9093known
D04370, Granisetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.9092known
D01316, Mexazolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9092known
D00714, Thiopental sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9092known
D01278, Oxazolam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.9091known
D07918, Estradiol hemihydratehsa:2100, (RefSeq) estrogen receptor 20.9089known
D01071, Hexobarbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9087known
D01744, Brotizolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9086known
D07962, Flecainide hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9086known
D01328, Clotiazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9084known
D04985, Methohexital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9084new - training
D08458, Quinidine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9084known
D00499, Pentobarbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9082known
D05261, Omeprazole sodium injection hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.9082known
D00455, Omeprazole hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.9081known
D00615, Amlodipine besylate hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.9081known
D01744, Brotizolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.908known
D08216, Mianserin hsa:3355, (RefSeq) 5-hydroxytryptamine receptor 1F0.9079known
D08376, Pilocarpine boratehsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9078known
D00470, Prazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9078known
D00067, Estrone hsa:2099, (RefSeq) estrogen receptor 10.9078known
D01372, Zopiclone hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9078known
D02624, Eszopiclone hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9078known
D08481, Rilmazafone hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9078known
D05261, Omeprazole sodium injection hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.9078known
D00455, Omeprazole hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.9078known
D00732, Chloroprocaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9077known
D01328, Clotiazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9077known
D00510, Phenylbutazone hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9077known
D00700, Mephobarbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9077known
D05343, Palonosetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.9077known
D01316, Mexazolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9076known
D01946, Oxitropium bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9075known
D08441, Propiverine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9074known
D08481, Rilmazafone hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9074known
D00700, Mephobarbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9072known
D06402, Sunitinib malate hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.9072known
D01268, Cloxazolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9071known
D02624, Eszopiclone hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9071known
D00700, Mephobarbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9071known
D00642, Quinidine gluconate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.907known
D07917, Esomeprazole hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.907known
D07886, Efonidipine hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.907known
D01744, Brotizolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.907known
D01564, Rilmazafone hydrochloride hydrate hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.907known
D02253, Pentobarbital calcium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.907known
D01744, Brotizolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9069known
D01279, Flutoprazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9069known
D00067, Estrone hsa:2100, (RefSeq) estrogen receptor 20.9068known
D08682, Warfarin hsa:79001, (RefSeq) vitamin K epoxide reductase complex subunit 10.9067known
D00638, Flecainide acetate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9067known
D07993, Fosphenytoin hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.9067known
D02253, Pentobarbital calcium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9067known
D07917, Esomeprazole hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.9067known
D07100, Amrubicin hydrochloride hsa:7155, (RefSeq) DNA topoisomerase II beta0.9067known
D07100, Amrubicin hydrochloride hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9066known
D02624, Eszopiclone hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9065known
D04107, Etoposide phosphate hsa:7155, (RefSeq) DNA topoisomerase II beta0.9065known
D01514, Etizolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9065known
D04107, Etoposide phosphate hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9064known
D07175, Palonosetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.9064known
D01455, Cifenline succinate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9064known
D07776, Daunorubicin hsa:7155, (RefSeq) DNA topoisomerase II beta0.9064known
D07776, Daunorubicin hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9064known
D01278, Oxazolam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9063known
D01372, Zopiclone hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9062known
D00615, Amlodipine besylate hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.9061known
D02624, Eszopiclone hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.906known
D02624, Eszopiclone hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.906known
D00525, Pilocarpine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9058known
D01593, Nimetazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9058known
D04061, Estradiol acetate hsa:2099, (RefSeq) estrogen receptor 10.9057known
D08224, Mitoxantrone hsa:7155, (RefSeq) DNA topoisomerase II beta0.9056known
D08224, Mitoxantrone hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9055known
D01744, Brotizolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9055known
D06678, Motesanib hsa:2324, (RefSeq) fms related receptor tyrosine kinase 40.9055known
D00726, Metoclopramide hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.9054known
D00700, Mephobarbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9053known
D07919, Estradiol 17 beta-hemisuccinatehsa:2099, (RefSeq) estrogen receptor 10.9053known
D04048, Ropivacaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9052known
D01744, Brotizolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9052known
D04048, Ropivacaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.9051known
D00763, Mivacurium chloride hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.9051known
D00696, Midazolam hydrochloride hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.905known
D08122, Levomethadone hydrochloridehsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.905known
D02253, Pentobarbital calcium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9049known
D00637, Disopyramide phosphate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9049known
D07481, Azasetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.9049known
D07866, Docetaxel hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9048known
D04061, Estradiol acetate hsa:2100, (RefSeq) estrogen receptor 20.9048known
D02165, Docetaxel hsa:10383, (RefSeq) tubulin beta 4B class IVb0.9047known
D02098, Proparacaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9047known
D00506, Phenobarbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9046known
D02698, Teniposide hsa:7155, (RefSeq) DNA topoisomerase II beta0.9046known
D00733, Dibucaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9045known
D05259, Omeprazole magnesium hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.9045known
D02698, Teniposide hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9045known
D08458, Quinidine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9044known
D00551, Tetracaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.9044known
D07919, Estradiol 17 beta-hemisuccinatehsa:2100, (RefSeq) estrogen receptor 20.9044known
D01278, Oxazolam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9043known
D01278, Oxazolam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.9043known
D09339, Esomeprazole potassium hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.9043known
D00227, Aminophylline hsa:135, (RefSeq) adenosine A2a receptor0.9042known
D00225, Alprazolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9042known
D02217, Raloxifene hydrochloride hsa:2099, (RefSeq) estrogen receptor 10.9042known
D01278, Oxazolam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.9042known
D05259, Omeprazole magnesium hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.9042known
D02624, Eszopiclone hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9042known
D01554, Pilsicainide hydrochloride hydrate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9042known
D08458, Quinidine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9041known
D02253, Pentobarbital calcium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9039known
D09339, Esomeprazole potassium hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.9039known
D05028, Midazolam maleate hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9039known
D02624, Eszopiclone hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9039known
D08377, Pilsicainide hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9037known
D00740, Procaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9037known
D01278, Oxazolam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.9036known
D02071, Scopolamine hydrobromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.9036known
D00706, Zolpidem tartrate hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.9034known
D00789, Chlorpromazine hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9034known
D02217, Raloxifene hydrochloride hsa:2100, (RefSeq) estrogen receptor 20.9033known
D02253, Pentobarbital calcium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9033known
D01122, Ibuprofen piconol hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9032known
D01278, Oxazolam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.9032known
D04034, Chlorpromazine phenolphthalinate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9031known
D08376, Pilocarpine boratehsa:1131, (RefSeq) cholinergic receptor muscarinic 30.903known
D07477, Atropine oxide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9028known
D00500, Pentobarbital sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9028known
D00789, Chlorpromazine hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.9027known
D08376, Pilocarpine boratehsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9026known
D01455, Cifenline succinate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9026known
D01501, Isoniazid calcium pyruvinate hsa:4129, (RefSeq) monoamine oxidase B0.9026known
D01747, Idarubicin hydrochloride hsa:7155, (RefSeq) DNA topoisomerase II beta0.9026known
D08559, Tamoxifen hsa:2099, (RefSeq) estrogen receptor 10.9026known
D07866, Docetaxel hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9026known
D01554, Pilsicainide hydrochloride hydrate hsa:3741, (RefSeq) potassium voltage-gated channel subfamily A member 50.9025known
D01747, Idarubicin hydrochloride hsa:7153, (RefSeq) DNA topoisomerase II alpha0.9025known
D02165, Docetaxel hsa:10382, (RefSeq) tubulin beta 4A class IVa0.9025known
D01278, Oxazolam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9025known
D07866, Docetaxel hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9025known
D02165, Docetaxel hsa:347733, (RefSeq) tubulin beta 2B class IIb0.9024known
D04985, Methohexital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.9023new - training
D01455, Cifenline succinate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9022known
D00525, Pilocarpine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9022known
D01245, Bromazepam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.9021known
D07866, Docetaxel hsa:203068, (RefSeq) tubulin beta class I0.9021known
D00375, Mephenytoin hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9021known
D02165, Docetaxel hsa:203068, (RefSeq) tubulin beta class I0.902known
D01071, Hexobarbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.902known
D02253, Pentobarbital calcium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.902known
D02253, Pentobarbital calcium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.902known
D06272, Sorafenib tosylate hsa:3815, (RefSeq) KIT proto-oncogene0.9019known
D08364, Phenylbutazone sodiumhsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9019known
D04064, Estradiol enanthate hsa:2099, (RefSeq) estrogen receptor 10.9019known
D01163, Ergonovine maleate hsa:3355, (RefSeq) 5-hydroxytryptamine receptor 1F0.9018known
D01372, Zopiclone hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.9017known
D08377, Pilsicainide hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9017known
D08441, Propiverine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.9017known
D01328, Clotiazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9017known
D08155, Manidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.9016known
D08559, Tamoxifen hsa:2100, (RefSeq) estrogen receptor 20.9016known
D00637, Disopyramide phosphate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.9015known
D08121, Levomethadone hsa:2906, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2D0.9015known
D01450, Bupivacaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.9014known
D01455, Cifenline succinate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9013known
D03011, Atropine oxide hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.9013known
D08481, Rilmazafone hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.901known
D00693, Chlordiazepoxide hydrochloride hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.901known
D04064, Estradiol enanthate hsa:2100, (RefSeq) estrogen receptor 20.9009known
D08458, Quinidine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.9009known
D02098, Proparacaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9009known
D02253, Pentobarbital calcium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9009known
D03814, Atropine methylbromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.9009known
D00637, Disopyramide phosphate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.9008known
D04985, Methohexital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.9007new - training
D00216, Acarbose hsa:2595, (RefSeq) glucosidase alpha0.9007known
D01765, Proglumetacin maleate hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9007known
D07866, Docetaxel hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9006known
D02069, Atropine sulfate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.9006known
D01278, Oxazolam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.9006known
D02165, Docetaxel hsa:7280, (RefSeq) tubulin beta 2A class IIa0.9006known
D01071, Hexobarbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9005known
D00672, Hydroxyzine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.9005known
D01316, Mexazolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.9005known
D00678, Ondansetron hydrochloride hydrate hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.9004known
D00118, Naproxen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.9004known
D00185, Estriol hsa:2099, (RefSeq) estrogen receptor 10.9004known
D10017, Naproxen etemesil hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.9004known
D01453, Caffeine hydrate hsa:135, (RefSeq) adenosine A2a receptor0.9004known
D00714, Thiopental sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.9003known
D01413, Estradiol valerate hsa:2099, (RefSeq) estrogen receptor 10.9003known
D00528, Caffeine hsa:135, (RefSeq) adenosine A2a receptor0.9002known
D01245, Bromazepam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.9002known
D06517, Pirmenol hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.9002known
D07595, Fosphenytoin sodium hydrate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.9002known
D02253, Pentobarbital calcium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.9002known
D08421, Procainamide hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.9001known
D01328, Clotiazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.9known
D00609, Prazosin hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.9known
D00615, Amlodipine besylate hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8997known
D01986, Estriol tripropionate hsa:2099, (RefSeq) estrogen receptor 10.8996known
D00185, Estriol hsa:2100, (RefSeq) estrogen receptor 20.8995known
D01866, Lornoxicam hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8995known
D01245, Bromazepam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8995known
D01413, Estradiol valerate hsa:2100, (RefSeq) estrogen receptor 20.8994known
D00637, Disopyramide phosphate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8994known
D01245, Bromazepam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8993known
D08481, Rilmazafone hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8993known
D08427, Proglumetacin hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8993known
D01765, Proglumetacin maleate hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8993known
D00456, Ondansetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8991known
D00138, Scopolamine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8991known
D01245, Bromazepam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8991known
D01316, Mexazolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8991known
D01004, Homatropine hydrobromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.899known
D00375, Mephenytoin hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8989known
D08155, Manidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8989known
D01280, Warfarin potassium hsa:79001, (RefSeq) vitamin K epoxide reductase complex subunit 10.8988known
D00470, Prazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8988known
D01986, Estriol tripropionate hsa:2100, (RefSeq) estrogen receptor 20.8986known
D00780, Bromocriptine mesylate hsa:1813, (RefSeq) dopamine receptor D20.8985known
D01744, Brotizolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8985known
D00700, Mephobarbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8984known
D04065, Estradiol undecylate hsa:2099, (RefSeq) estrogen receptor 10.8984known
D08620, Toremifene hsa:2099, (RefSeq) estrogen receptor 10.8983known
D08459, Quinidine phenylethylbarbituratehsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8983known
D00375, Mephenytoin hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8982known
D02166, Mitoxantrone hydrochloride hsa:7155, (RefSeq) DNA topoisomerase II beta0.8981known
D00970, Naproxen sodium hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.898known
D08427, Proglumetacin hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.898known
D07866, Docetaxel hsa:84617, (RefSeq) tubulin beta 6 class V0.898known
D02166, Mitoxantrone hydrochloride hsa:7153, (RefSeq) DNA topoisomerase II alpha0.898known
D02165, Docetaxel hsa:84617, (RefSeq) tubulin beta 6 class V0.8979known
D01514, Etizolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8978known
D01279, Flutoprazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8978known
D08463, Rabeprazole hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8978known
D07845, Diltiazem hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8977known
D08441, Propiverine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8976known
D02272, Quinidine sulfate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8976known
D00616, Diltiazem hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8975known
D02624, Eszopiclone hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8975known
D08463, Rabeprazole hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8974known
D04065, Estradiol undecylate hsa:2100, (RefSeq) estrogen receptor 20.8974known
D00821, Venlafaxine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8974known
D08620, Toremifene hsa:2100, (RefSeq) estrogen receptor 20.8974known
D00525, Pilocarpine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8974known
D07595, Fosphenytoin sodium hydrate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8973known
D01613, Azasetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8973known
D01326, Aprindine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8973known
D07892, Enalapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8972known
D00147, Hyoscyamine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8971known
D04479, Hyoscyamine hydrobromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8971known
D02355, Tolmetin hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.897known
D00700, Mephobarbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.897known
D05478, Pilocarpine nitrate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8969known
D06678, Motesanib hsa:3791, (RefSeq) kinase insert domain receptor0.8969known
D01744, Brotizolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8969known
D08382, Piperidolate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8969known
D05478, Pilocarpine nitrate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8968known
D08155, Manidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8968known
D01564, Rilmazafone hydrochloride hydrate hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8966known
D08284, Norepinephrine hydrochoridehsa:147, (RefSeq) adrenoceptor alpha 1B0.8966known
D01004, Homatropine hydrobromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8965known
D01952, L-Methylephedrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8964known
D02109, dl-Methylephedrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8964known
D01245, Bromazepam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8964known
D01077, Methylatropine nitrate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8963known
D00270, Chlorpromazine hsa:1813, (RefSeq) dopamine receptor D20.8963known
D00375, Mephenytoin hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8962known
D00383, Trandolapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8962known
D07595, Fosphenytoin sodium hydrate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8961known
D01071, Hexobarbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.896known
D01278, Oxazolam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8959known
D02624, Eszopiclone hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8959known
D00696, Midazolam hydrochloride hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8959known
D08422, Procaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8959new - training
D01514, Etizolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8959known
D01316, Mexazolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8959known
D07595, Fosphenytoin sodium hydrate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8958known
D00225, Alprazolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8957known
D01358, Mianserin hydrochloride hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8956known
D05095, Mycophenolate sodium hsa:3614, (RefSeq) inosine monophosphate dehydrogenase 10.8955known
D05008, Metoclopramide hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8954known
D02355, Tolmetin hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8952known
D08690, Zolpidem hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8952known
D08552, Sunitinib hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.8951known
D07580, Aspirin DL-lysine hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8951known
D00219, Acetohexamide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.8951known
D07905, Ergometrine hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.895known
D01479, Ambroxol hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.895known
D02103, Phenytoin sodium hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8949known
D07845, Diltiazem hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8948known
D00763, Mivacurium chloride hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.8948known
D00113, Atropine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8947known
D08690, Zolpidem hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8947known
D05478, Pilocarpine nitrate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8947known
D01245, Bromazepam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8946known
D04985, Methohexital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8946new - training
D01564, Rilmazafone hydrochloride hydrate hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8946known
D00719, Hyoscyamine sulfate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8946known
D00616, Diltiazem hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8946known
D00706, Zolpidem tartrate hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8945known
D08459, Quinidine phenylethylbarbituratehsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8945known
D01245, Bromazepam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8944known
D00700, Mephobarbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8943known
D01328, Clotiazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8943known
D04965, Perphenazine hydrochloridehsa:1813, (RefSeq) dopamine receptor D20.8942known
D08459, Quinidine phenylethylbarbituratehsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8942known
D00724, Rabeprazole sodium hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8942known
D01278, Oxazolam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8942known
D08364, Phenylbutazone sodiumhsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8941known
D01004, Homatropine hydrobromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8941known
D08481, Rilmazafone hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.894known
D07905, Ergometrine hsa:3355, (RefSeq) 5-hydroxytryptamine receptor 1F0.894known
D02910, Amiodarone hsa:3784, (RefSeq) potassium voltage-gated channel subfamily Q member 10.8939known
D02253, Pentobarbital calcium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8939known
D00225, Alprazolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8938known
D05333, Paclitaxel poliglumex hsa:81027, (RefSeq) tubulin beta 1 class VI0.8938known
D00724, Rabeprazole sodium hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8938known
D06678, Motesanib hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.8938known
D08667, Calcium valproatehsa:253175, (RefSeq) chromodomain Y-linked 1B0.8936known
D08131, Lisinopril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8936known
D02213, Metoclopramide hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8934known
D08690, Zolpidem hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8932known
D08667, Calcium valproatehsa:203611, (RefSeq) chromodomain Y-linked 2B0.8931known
D08667, Calcium valproatehsa:9426, (RefSeq) chromodomain Y-linked 2A0.8931known
D02096, Fosphenytoin sodium hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8931known
D05333, Paclitaxel poliglumex hsa:10381, (RefSeq) tubulin beta 3 class III0.8931known
D01565, Indometacin farnesil hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.893known
D04370, Granisetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.893known
D00454, Olanzapine hsa:148, (RefSeq) adrenoceptor alpha 1A0.893known
D00719, Hyoscyamine sulfate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8929known
D01785, Pirmenol hydrochloride hydrate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8929known
D08618, Topotecan hsa:7150, (RefSeq) DNA topoisomerase I0.8929known
D07845, Diltiazem hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8928known
D01582, Acemetacin hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8928known
D00720, Mepenzolate bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8928known
D00551, Tetracaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8928known
D08122, Levomethadone hydrochloridehsa:2905, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2C0.8927known
D01245, Bromazepam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8927known
D00616, Diltiazem hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8927known
D02579, Iproniazid hsa:4128, (RefSeq) monoamine oxidase A0.8926known
D01372, Zopiclone hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8926known
D08690, Zolpidem hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8926known
D00719, Hyoscyamine sulfate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8925known
D02253, Pentobarbital calcium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8924known
D07866, Docetaxel hsa:347688, (RefSeq) tubulin beta 8 class VIII0.8924known
D00491, Paclitaxel hsa:10383, (RefSeq) tubulin beta 4B class IVb0.8924known
D02165, Docetaxel hsa:347688, (RefSeq) tubulin beta 8 class VIII0.8924known
D00677, Granisetron hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8922known
D02200, Pilocarpine hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8922known
D03769, Enalaprilat hsa:1636, (RefSeq) angiotensin I converting enzyme0.8921known
D08690, Zolpidem hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8921known
D00362, Lisinopril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8921known
D00399, Valproic acid hsa:253175, (RefSeq) chromodomain Y-linked 1B0.8921known
D01744, Brotizolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8921known
D00510, Phenylbutazone hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.892known
D01866, Lornoxicam hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8919known
D00379, Tolazamide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.8918known
D02070, Homatropine methylbromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8918known
D08459, Quinidine phenylethylbarbituratehsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8918known
D02200, Pilocarpine hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8918known
D01582, Acemetacin hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8916known
D00399, Valproic acid hsa:203611, (RefSeq) chromodomain Y-linked 2B0.8916known
D00399, Valproic acid hsa:9426, (RefSeq) chromodomain Y-linked 2A0.8916known
D00789, Chlorpromazine hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8915known
D01648, Hyoscyamine methylbromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8915known
D00789, Chlorpromazine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8913known
D07905, Ergometrine hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8913known
D01450, Bupivacaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8911known
D07520, Bepridil hsa:3784, (RefSeq) potassium voltage-gated channel subfamily Q member 10.8911known
D07981, Fluticasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8909known
D08376, Pilocarpine boratehsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8909known
D08668, Vardenafil hsa:8654, (RefSeq) phosphodiesterase 5A0.8908known
D08155, Manidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8908known
D07590, Bupranolol hsa:153, (RefSeq) adrenoceptor beta 10.8907known
D02168, Topotecan hydrochloride hsa:7150, (RefSeq) DNA topoisomerase I0.8907known
D03826, Physostigmine sulfate hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.8907known
D01372, Zopiclone hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8907known
D00512, Phenytoin hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8906known
D02624, Eszopiclone hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8906known
D01984, Esomeprazole magnesium hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8906known
D01450, Bupivacaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8906known
D06216, Triamcinolone acetonide sodium phosphate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8905known
D00733, Dibucaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8905known
D00491, Paclitaxel hsa:10382, (RefSeq) tubulin beta 4A class IVa0.8903known
D01984, Esomeprazole magnesium hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8902known
D00609, Prazosin hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8902known
D07993, Fosphenytoin hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8901known
D00491, Paclitaxel hsa:347733, (RefSeq) tubulin beta 2B class IIb0.8901known
D01806, Oxprenolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8901known
D08690, Zolpidem hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.89known
D01514, Etizolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8899known
D08690, Zolpidem hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8899known
D00491, Paclitaxel hsa:203068, (RefSeq) tubulin beta class I0.8898known
D02037, Perphenazine maleate hsa:1813, (RefSeq) dopamine receptor D20.8898known
D00454, Olanzapine hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8898known
D00454, Olanzapine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8897known
D08441, Propiverine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8897known
D00525, Pilocarpine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8896known
D00642, Quinidine gluconate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8896known
D00789, Chlorpromazine hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8895known
D08690, Zolpidem hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8895known
D05353, Pantoprazole hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8895known
D02969, Aprindine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8895known
D08048, Hydroquinidine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8894known
D00399, Valproic acid hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8893known
D00267, Chlordiazepoxide hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8893known
D05353, Pantoprazole hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8891known
D02212, Ipratropium bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8891known
D08614, Tolazoline hsa:148, (RefSeq) adrenoceptor alpha 1A0.889known
D02731, Vardenafil dihydrochoride hsa:8654, (RefSeq) phosphodiesterase 5A0.889known
D03260, Vardenafil hydrochloride hydrate hsa:8654, (RefSeq) phosphodiesterase 5A0.8889known
D00726, Metoclopramide hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8889known
D07481, Azasetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8888known
D02362, Paroxetine hsa:6532, (RefSeq) solute carrier family 6 member 40.8887known
D01564, Rilmazafone hydrochloride hydrate hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8887known
D03830, Diltiazem malate hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8887known
D00267, Chlordiazepoxide hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8886known
D00725, Dolasetron mesylate hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8885known
D00789, Chlorpromazine hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8884known
D08690, Zolpidem hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8883known
D00491, Paclitaxel hsa:7280, (RefSeq) tubulin beta 2A class IIa0.8883known
D00399, Valproic acid hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8882known
D00138, Scopolamine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8882known
D08947, Motesanib diphosphate hsa:2324, (RefSeq) fms related receptor tyrosine kinase 40.8881known
D01604, Efonidipine hydrochloride ethanolate hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8879known
D00225, Alprazolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8879known
D02200, Pilocarpine hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8877known
D02016, Ramosetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8876known
D08569, Terazosin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8876known
D04048, Ropivacaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8875known
D00970, Naproxen sodium hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8875known
D08667, Calcium valproatehsa:9085, (RefSeq) chromodomain Y-linked 10.8875known
D04031, Rubitecan hsa:7150, (RefSeq) DNA topoisomerase I0.8874known
D07129, Alosetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8874known
D01911, Aclarubicin hydrochloride hsa:7153, (RefSeq) DNA topoisomerase II alpha0.8874known
D00966, Tamoxifen citrate hsa:2099, (RefSeq) estrogen receptor 10.8873known
D02253, Pentobarbital calcium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8873known
D01278, Oxazolam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8873known
D01911, Aclarubicin hydrochloride hsa:7155, (RefSeq) DNA topoisomerase II beta0.8872known
D03274, Chlorpromazine hibenzate hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8872known
D00477, Procainamide hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8872known
D08365, Phenylephrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8872known
D02071, Scopolamine hydrobromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8871known
D00733, Dibucaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8871known
D08382, Piperidolate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8869known
D01071, Hexobarbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8869known
D01946, Oxitropium bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8868known
D07845, Diltiazem hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8868known
D05343, Palonosetron hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8868known
D00267, Chlordiazepoxide hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8867known
D00631, Bepridil hydrochloride hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8866known
D00454, Olanzapine hsa:1814, (RefSeq) dopamine receptor D30.8866known
D00616, Diltiazem hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8865known
D01328, Clotiazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8864known
D00966, Tamoxifen citrate hsa:2100, (RefSeq) estrogen receptor 20.8864known
D00244, Betamethasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8864known
D01004, Homatropine hydrobromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8862known
D08382, Piperidolate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8861known
D00267, Chlordiazepoxide hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8861known
D03830, Diltiazem malate hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.886known
D01245, Bromazepam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8859known
D02002, Isoniazid sodium methanesulfonate hydrate hsa:4128, (RefSeq) monoamine oxidase A0.8859known
D00399, Valproic acid hsa:9085, (RefSeq) chromodomain Y-linked 10.8859known
D08481, Rilmazafone hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8859known
D01316, Mexazolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8859known
D08048, Hydroquinidine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8858known
D00458, Quetiapine fumarate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8857known
D08953, Nilotinib hsa:3815, (RefSeq) KIT proto-oncogene0.8856known
D08363, Phenylbutazone calciumhsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8856known
D02071, Scopolamine hydrobromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8856known
D00491, Paclitaxel hsa:84617, (RefSeq) tubulin beta 6 class V0.8856known
D07175, Palonosetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8856known
D00270, Chlorpromazine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8855known
D08048, Hydroquinidine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8855known
D00434, Simvastatin hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8855known
D07520, Bepridil hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8855known
D07886, Efonidipine hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8854known
D01604, Efonidipine hydrochloride ethanolate hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8854known
D00267, Chlordiazepoxide hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8854known
D00710, Valproate sodium hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8854known
D00335, Glipizide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.8852known
D00359, Lovastatin hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8852known
D02829, Alosetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8852known
D07477, Atropine oxide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8852known
D04985, Methohexital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8851new - training
D02086, Lidocaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.885known
D01071, Hexobarbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.885known
D07442, Ambroxol hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8849known
D07580, Aspirin DL-lysine hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8849known
D07962, Flecainide hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8848known
D01372, Zopiclone hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8848known
D08688, Zofenopril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8847known
D02086, Lidocaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8847known
D00267, Chlordiazepoxide hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8846known
D00678, Ondansetron hydrochloride hydrate hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8845known
D01328, Clotiazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8845known
D00267, Chlordiazepoxide hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8845known
D00540, Glycopyrrolate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8845known
D08284, Norepinephrine hydrochoridehsa:148, (RefSeq) adrenoceptor alpha 1A0.8845known
D00358, Lidocaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8845known
D02910, Amiodarone hsa:3760, (RefSeq) potassium inwardly rectifying channel subfamily J member 30.8844known
D00710, Valproate sodium hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8844known
D01245, Bromazepam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8844known
D02350, Fenoprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8842known
D02130, Tropisetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8842known
D08116, Levobupivacaine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8842new - training
D00358, Lidocaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8841known
D08481, Rilmazafone hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.884known
D06517, Pirmenol hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.884known
D03830, Diltiazem malate hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.884known
D01952, L-Methylephedrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8839known
D02109, dl-Methylephedrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8839known
D01145, Azelnidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8839known
D01316, Mexazolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8838known
D00957, Testosterone cypionate hsa:367, (RefSeq) androgen receptor0.8838known
D01175, Carpronium chloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8838known
D01441, Imatinib mesylate hsa:3815, (RefSeq) KIT proto-oncogene0.8838known
D03011, Atropine oxide hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8837known
D00700, Mephobarbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8837known
D01226, Sulpiride hsa:1813, (RefSeq) dopamine receptor D20.8837known
D01175, Carpronium chloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8837known
D08614, Tolazoline hsa:147, (RefSeq) adrenoceptor alpha 1B0.8836known
D00789, Chlorpromazine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8836known
D06402, Sunitinib malate hsa:2321, (RefSeq) fms related receptor tyrosine kinase 10.8835known
D00985, Triamcinolone hexacetonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8834known
D07838, Dihydroergotamine tartratehsa:1813, (RefSeq) dopamine receptor D20.8834known
D08426, Profenamine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8834known
D01744, Brotizolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8834known
D03274, Chlorpromazine hibenzate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8833known
D08048, Hydroquinidine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8832known
D00458, Quetiapine fumarate hsa:1814, (RefSeq) dopamine receptor D30.8831known
D01245, Bromazepam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8831known
D04063, Estradiol cypionate hsa:2099, (RefSeq) estrogen receptor 10.8831known
D00813, Ketorolac tromethamine hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8831known
D00456, Ondansetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.883known
D01254, Tofisopam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.883known
D00267, Chlordiazepoxide hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8829known
D05478, Pilocarpine nitrate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8828known
D08614, Tolazoline hsa:151, (RefSeq) adrenoceptor alpha 2B0.8828known
D08465, Raloxifene hsa:2099, (RefSeq) estrogen receptor 10.8828known
D09752, Carpronium chloride hydrate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8828known
D00267, Chlordiazepoxide hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8827known
D08426, Profenamine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8827known
D01554, Pilsicainide hydrochloride hydrate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8827known
D00537, Topiramate hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8825known
D00813, Ketorolac tromethamine hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8825known
D01163, Ergonovine maleate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8825known
D02624, Eszopiclone hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8824known
D01604, Efonidipine hydrochloride ethanolate hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8822known
D08458, Quinidine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8822known
D02358, Metoprolol hsa:153, (RefSeq) adrenoceptor beta 10.8822known
D01358, Mianserin hydrochloride hsa:3355, (RefSeq) 5-hydroxytryptamine receptor 1F0.8822known
D04063, Estradiol cypionate hsa:2100, (RefSeq) estrogen receptor 20.8821known
D01175, Carpronium chloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8821known
D09752, Carpronium chloride hydrate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8819known
D08465, Raloxifene hsa:2100, (RefSeq) estrogen receptor 20.8818known
D00701, Phenobarbital sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8818known
D01254, Tofisopam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8818known
D07999, Sodium furosemidehsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8817known
D08408, Pranlukast hsa:10800, (RefSeq) cysteinyl leukotriene receptor 10.8817known
D00700, Mephobarbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8816known
D01565, Indometacin farnesil hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8816known
D00955, Nandrolone decanoate hsa:367, (RefSeq) androgen receptor0.8816known
D08690, Zolpidem hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8816known
D07999, Sodium furosemidehsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8816known
D08490, Ropivacaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8815known
D01744, Brotizolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8815known
D07519, Benzylthiouracilhsa:7173, (RefSeq) thyroid peroxidase0.8814known
D01604, Efonidipine hydrochloride ethanolate hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8812known
D04056, Esomeprazole sodium hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8812known
D01145, Azelnidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8811known
D01514, Etizolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8811known
D09752, Carpronium chloride hydrate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.881known
D00631, Bepridil hydrochloride hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.881known
D08377, Pilsicainide hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.881known
D01946, Oxitropium bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.881known
D00514, Dexmedetomidine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8809known
D00719, Hyoscyamine sulfate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8808known
D04056, Esomeprazole sodium hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8808known
D02041, Tropisetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8808known
D01278, Oxazolam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8807known
D01455, Cifenline succinate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8807known
D08426, Profenamine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8805known
D02624, Eszopiclone hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8805known
D02272, Quinidine sulfate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8805known
D00637, Disopyramide phosphate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8804known
D02034, Setiptiline maleate hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8803known
D08490, Ropivacaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8803known
D08421, Procainamide hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8802known
D02567, Escitalopram oxalate hsa:6532, (RefSeq) solute carrier family 6 member 40.8802known
D00454, Olanzapine hsa:1813, (RefSeq) dopamine receptor D20.8802known
D00822, Citalopram hydrobromide hsa:6532, (RefSeq) solute carrier family 6 member 40.8802known
D00491, Paclitaxel hsa:347688, (RefSeq) tubulin beta 8 class VIII0.8801known
D08690, Zolpidem hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8801known
D01254, Tofisopam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8799known
D00701, Phenobarbital sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8799known
D01182, Alprenolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8798known
D01564, Rilmazafone hydrochloride hydrate hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8798known
D08207, Methylergometrine hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8798known
D01326, Aprindine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8797known
D00680, Methylergonovine maleate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8796known
D08365, Phenylephrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8796known
D07931, Etilefrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8795known
D00710, Valproate sodium hsa:253175, (RefSeq) chromodomain Y-linked 1B0.8795known
D02200, Pilocarpine hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8794known
D08181, Mepivacaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8794new - training
D02212, Ipratropium bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8794known
D00458, Quetiapine fumarate hsa:1813, (RefSeq) dopamine receptor D20.8793known
D02246, Biperiden hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8793known
D01254, Tofisopam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8793known
D07886, Efonidipine hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8792known
D00124, Ephedrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8791known
D05008, Metoclopramide hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8791known
D01071, Hexobarbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8791known
D01145, Azelnidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8791known
D08253, Naphazoline hsa:148, (RefSeq) adrenoceptor alpha 1A0.8791known
D00225, Alprazolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8791known
D00710, Valproate sodium hsa:203611, (RefSeq) chromodomain Y-linked 2B0.879known
D00710, Valproate sodium hsa:9426, (RefSeq) chromodomain Y-linked 2A0.879known
D00399, Valproic acid hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8789known
D01278, Oxazolam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8789known
D00996, Epinephrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8789known
D07520, Bepridil hsa:3760, (RefSeq) potassium inwardly rectifying channel subfamily J member 30.8788known
D08127, Lidocaine hydrochloride monohydratehsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8788known
D01328, Clotiazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8787known
D01254, Tofisopam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8787known
D00958, Testosterone enanthate hsa:367, (RefSeq) androgen receptor0.8785known
D08947, Motesanib diphosphate hsa:3791, (RefSeq) kinase insert domain receptor0.8785known
D08425, Procyclidine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8784known
D07409, Pentetrazol hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8784known
D02593, Pantoprazole sodium hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8784known
D08549, Sultopride hsa:1813, (RefSeq) dopamine receptor D20.8784known
D00426, Risperidone hsa:1813, (RefSeq) dopamine receptor D20.8784known
D01254, Tofisopam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8784known
D00481, Propantheline bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8784known
D02732, Pranlukast hydrate hsa:10800, (RefSeq) cysteinyl leukotriene receptor 10.8784known
D01254, Tofisopam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8784known
D02253, Pentobarbital calcium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8784known
D02103, Phenytoin sodium hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8784known
D02350, Fenoprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8783known
D00683, Albuterol sulfate hsa:154, (RefSeq) adrenoceptor beta 20.8783known
D08116, Levobupivacaine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8782new - training
D08207, Methylergometrine hsa:3355, (RefSeq) 5-hydroxytryptamine receptor 1F0.8782known
D08481, Rilmazafone hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8782known
D08410, Pravastatin hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8781known
D01163, Ergonovine maleate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8781known
D00465, Oxybutynin hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8781known
D00551, Tetracaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8781known
D02593, Pantoprazole sodium hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8781known
D02246, Biperiden hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8781known
D01316, Mexazolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.878known
D00701, Phenobarbital sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.878known
D07520, Bepridil hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8779known
D03830, Diltiazem malate hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8778known
D00552, Benzocaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8778known
D01939, Ziprasidone hydrochloride hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8778known
D00355, Lansoprazole hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8778known
D00331, Furosemide hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8777known
D02147, Albuterol hsa:154, (RefSeq) adrenoceptor beta 20.8777known
D00763, Mivacurium chloride hsa:1140, (RefSeq) cholinergic receptor nicotinic beta 1 subunit0.8777known
D00331, Furosemide hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8776known
D00417, Milrinone hsa:5140, (RefSeq) phosphodiesterase 3B0.8775known
D02910, Amiodarone hsa:3767, (RefSeq) potassium inwardly rectifying channel subfamily J member 110.8775known
D01939, Ziprasidone hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8774known
D00375, Mephenytoin hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8774known
D00701, Phenobarbital sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8774known
D00355, Lansoprazole hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8773known
D00721, Methanthelinium bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8773known
D02100, Ziprasidone mesylate hsa:1813, (RefSeq) dopamine receptor D20.8773known
D00638, Flecainide acetate hsa:3752, (RefSeq) potassium voltage-gated channel subfamily D member 30.8773known
D07962, Flecainide hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8772known
D00701, Phenobarbital sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8772known
D02213, Metoclopramide hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8771known
D00631, Bepridil hydrochloride hsa:3784, (RefSeq) potassium voltage-gated channel subfamily Q member 10.8771known
D00701, Phenobarbital sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8771known
D00481, Propantheline bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8769known
D01325, Tiaprofenic acid hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8769known
D00721, Methanthelinium bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8769known
D08127, Lidocaine hydrochloride monohydratehsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8768known
D00138, Scopolamine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8768known
D00701, Phenobarbital sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8767known
D02253, Pentobarbital calcium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8767known
D01254, Tofisopam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8766known
D02096, Fosphenytoin sodium hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8766known
D00538, Zonisamide hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8766known
D01613, Azasetron hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8766known
D00267, Chlordiazepoxide hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8764known
D07999, Sodium furosemidehsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8764known
D08690, Zolpidem hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8763known
D07409, Pentetrazol hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8763known
D08569, Terazosin hsa:147, (RefSeq) adrenoceptor alpha 1B0.8763known
D07520, Bepridil hsa:3752, (RefSeq) potassium voltage-gated channel subfamily D member 30.8762known
D07595, Fosphenytoin sodium hydrate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8761known
D01254, Tofisopam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8761known
D02032, Betamethasone butyrate propionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8761known
D01372, Zopiclone hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8761known
D00219, Acetohexamide hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.876known
D00680, Methylergonovine maleate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.876known
D08207, Methylergometrine hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.876known
D00700, Mephobarbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.876known
D00721, Methanthelinium bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8758known
D00779, Biperiden hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8757known
D08421, Procainamide hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8757known
D01325, Tiaprofenic acid hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8757known
D01744, Brotizolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8757known
D03274, Chlorpromazine hibenzate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8756known
D00710, Valproate sodium hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8756known
D08181, Mepivacaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8756new - training
D08322, Oxymetazoline hsa:148, (RefSeq) adrenoceptor alpha 1A0.8756known
D04034, Chlorpromazine phenolphthalinate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8756known
D08318, Oxprenolol hsa:153, (RefSeq) adrenoceptor beta 10.8755known
D02071, Scopolamine hydrobromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8755known
D08421, Procainamide hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8755known
D00701, Phenobarbital sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8754known
D03449, Cetamolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8754known
D02100, Ziprasidone mesylate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8754known
D01554, Pilsicainide hydrochloride hydrate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8752known
D01163, Ergonovine maleate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8752known
D00394, Trimipramine hsa:6532, (RefSeq) solute carrier family 6 member 40.8752known
D00374, Thiothixene hsa:1813, (RefSeq) dopamine receptor D20.8751known
D08411, Prazosin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8751known
D09032, Vinflunine ditartrate hsa:10383, (RefSeq) tubulin beta 4B class IVb0.875new - training
D08382, Piperidolate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.875known
D01553, Manidipine hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.875known
D01946, Oxitropium bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.875known
D00732, Chloroprocaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8749known
D01708, Fluticasone propionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8749known
D08953, Nilotinib hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8749known
D00417, Milrinone hsa:5139, (RefSeq) phosphodiesterase 3A0.8749known
D00118, Naproxen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8748known
D07805, Dexfenfluramine hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8748known
D00267, Chlordiazepoxide hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8748known
D05575, Pramipexole hsa:1813, (RefSeq) dopamine receptor D20.8748known
D02070, Homatropine methylbromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8747known
D02624, Eszopiclone hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8747known
D01479, Ambroxol hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8747known
D02246, Biperiden hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8747known
D00610, Terazosin hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8746known
D00432, Nadolol hsa:153, (RefSeq) adrenoceptor beta 10.8746known
D08595, Tiemonium methylsulfatehsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8746known
D00715, Methscopolamine bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8746known
D08363, Phenylbutazone calciumhsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8745known
D07409, Pentetrazol hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8744known
D01952, L-Methylephedrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8744known
D02109, dl-Methylephedrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8744known
D08284, Norepinephrine hydrochoridehsa:146, (RefSeq) adrenoceptor alpha 1D0.8744known
D01637, Betamethasone dipropionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8743known
D00701, Phenobarbital sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8743known
D08001, Furosemide diolaminehsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8742known
D00512, Phenytoin hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8741known
D00252, Carbamazepine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.874known
D03658, Dasatinib hsa:6714, (RefSeq) SRC proto-oncogene0.874known
D00076, Noradrenaline hsa:147, (RefSeq) adrenoceptor alpha 1B0.8739known
D07409, Pentetrazol hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8739known
D00481, Propantheline bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8738known
D07409, Pentetrazol hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8738known
D02212, Ipratropium bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8738known
D07409, Pentetrazol hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8737known
D08001, Furosemide diolaminehsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8737known
D00631, Bepridil hydrochloride hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8737known
D01441, Imatinib mesylate hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8737known
D08127, Lidocaine hydrochloride monohydratehsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8737known
D04034, Chlorpromazine phenolphthalinate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8736known
D00514, Dexmedetomidine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8735known
D01709, Loxoprofen sodium hydrate hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8735known
D08216, Mianserin hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8735known
D08435, Propafenone hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8734known
D00710, Valproate sodium hsa:9085, (RefSeq) chromodomain Y-linked 10.8734known
D00636, Amiodarone hydrochloride hsa:3784, (RefSeq) potassium voltage-gated channel subfamily Q member 10.8733known
D03274, Chlorpromazine hibenzate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8732known
D08128, Liothyronine hsa:7067, (RefSeq) thyroid hormone receptor alpha0.8732known
D07409, Pentetrazol hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8732known
D07999, Sodium furosemidehsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8732known
D01145, Azelnidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8732known
D01205, Dexmedetomidine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8731known
D01785, Pirmenol hydrochloride hydrate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8731known
D01287, Levobupivacaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.873known
D01278, Oxazolam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.873known
D08459, Quinidine phenylethylbarbituratehsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8729known
D08377, Pilsicainide hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8729known
D00379, Tolazamide hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.8729known
D09032, Vinflunine ditartrate hsa:10382, (RefSeq) tubulin beta 4A class IVa0.8729new - training
D09032, Vinflunine ditartrate hsa:347733, (RefSeq) tubulin beta 2B class IIb0.8728new - training
D02070, Homatropine methylbromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8727known
D07818, Diclofenac hydroxyethylpyrrolidinehsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8727known
D00525, Pilocarpine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8727known
D05606, Prenalterol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8727known
D00725, Dolasetron mesylate hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8726known
D08376, Pilocarpine boratehsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8725known
D08284, Norepinephrine hydrochoridehsa:155, (RefSeq) adrenoceptor beta 30.8725known
D06162, Tiprenolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8724new - training
D04370, Granisetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8724known
D00331, Furosemide hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8724known
D09032, Vinflunine ditartrate hsa:203068, (RefSeq) tubulin beta class I0.8724new - training
D08490, Ropivacaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8723known
D06495, Octreotide acetate hsa:6753, (RefSeq) somatostatin receptor 30.8722known
D01010, Levothyroxine sodium hsa:7067, (RefSeq) thyroid hormone receptor alpha0.8722known
D08122, Levomethadone hydrochloridehsa:2906, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2D0.8722known
D07962, Flecainide hsa:3752, (RefSeq) potassium voltage-gated channel subfamily D member 30.8721known
D07409, Pentetrazol hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8721known
D01553, Manidipine hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.872known
D02969, Aprindine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8719known
D02085, Milrinone lactatehsa:5140, (RefSeq) phosphodiesterase 3B0.8718known
D02016, Ramosetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8718known
D08441, Propiverine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8717known
D07129, Alosetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8717known
D01165, Piperidolate hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8717known
D02250, Octreotide acetate hsa:6753, (RefSeq) somatostatin receptor 30.8716known
D08667, Calcium valproatehsa:18, (RefSeq) 4-aminobutyrate aminotransferase0.8716known
D07866, Docetaxel hsa:81027, (RefSeq) tubulin beta 1 class VI0.8716known
D02165, Docetaxel hsa:81027, (RefSeq) tubulin beta 1 class VI0.8715known
D00779, Biperiden hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8715known
D00680, Methylergonovine maleate hsa:3355, (RefSeq) 5-hydroxytryptamine receptor 1F0.8715known
D08216, Mianserin hsa:147, (RefSeq) adrenoceptor alpha 1B0.8715known
D08687, Ziprasidone hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8714known
D02356, Verapamil hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8714known
D01175, Carpronium chloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8714known
D04034, Chlorpromazine phenolphthalinate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8714known
D00756, Tetrahydrozoline nitrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8713known
D01245, Bromazepam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8713known
D01479, Ambroxol hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8712known
D05529, Podofilox hsa:7155, (RefSeq) DNA topoisomerase II beta0.8712known
D09032, Vinflunine ditartrate hsa:7280, (RefSeq) tubulin beta 2A class IIa0.8712new - training
D08947, Motesanib diphosphate hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.8711known
D05529, Podofilox hsa:7153, (RefSeq) DNA topoisomerase II alpha0.8711known
D08614, Tolazoline hsa:150, (RefSeq) adrenoceptor alpha 2A0.8711known
D07866, Docetaxel hsa:10381, (RefSeq) tubulin beta 3 class III0.8709known
D08128, Liothyronine hsa:7068, (RefSeq) thyroid hormone receptor beta0.8709known
D02165, Docetaxel hsa:10381, (RefSeq) tubulin beta 3 class III0.8709known
D08426, Profenamine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8709known
D07461, Apraclonidine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8708known
D02253, Pentobarbital calcium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8708known
D01287, Levobupivacaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8708known
D07409, Pentetrazol hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8707known
D01479, Ambroxol hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8707known
D00403, Methotrimeprazine hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8706known
D01285, Lofepramine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8706known
D07520, Bepridil hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8705known
D07931, Etilefrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8705known
D07520, Bepridil hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8705known
D01071, Hexobarbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8703known
D01887, Bunazosin hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8703known
D01254, Tofisopam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8702known
D00779, Biperiden hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8702known
D01553, Manidipine hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8702known
D07540, Brimonidine hsa:151, (RefSeq) adrenoceptor alpha 2B0.87known
D08466, Ramosetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.87known
D01010, Levothyroxine sodium hsa:7068, (RefSeq) thyroid hormone receptor beta0.87known
D06495, Octreotide acetate hsa:6754, (RefSeq) somatostatin receptor 40.87known
D00640, Propafenone hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.87known
D00389, Metandienone hsa:367, (RefSeq) androgen receptor0.8699known
D01163, Ergonovine maleate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8699known
D02356, Verapamil hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8699known
D01069, Cilazapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8699known
D01328, Clotiazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8699known
D08421, Procainamide hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8699known
D00267, Chlordiazepoxide hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8698known
D00454, Olanzapine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8697known
D00399, Valproic acid hsa:18, (RefSeq) 4-aminobutyrate aminotransferase0.8697known
D01316, Mexazolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8695known
D05375, Paroxetine mesylate hsa:6532, (RefSeq) solute carrier family 6 member 40.8695known
D02829, Alosetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8694known
D08481, Rilmazafone hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8694known
D01245, Bromazepam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8694known
D02250, Octreotide acetate hsa:6754, (RefSeq) somatostatin receptor 40.8693known
D00354, Lamotrigine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8693known
D08595, Tiemonium methylsulfatehsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8693known
D09752, Carpronium chloride hydrate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8692known
D00331, Furosemide hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8692known
D02085, Milrinone lactatehsa:5139, (RefSeq) phosphodiesterase 3A0.8692known
D00726, Metoclopramide hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8691known
D07699, Cilazapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8691known
D02098, Proparacaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.869known
D08595, Tiemonium methylsulfatehsa:1132, (RefSeq) cholinergic receptor muscarinic 40.869known
D00701, Phenobarbital sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.869known
D01004, Homatropine hydrobromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8688known
D01479, Ambroxol hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8688known
D00677, Granisetron hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8688known
D09032, Vinflunine ditartrate hsa:84617, (RefSeq) tubulin beta 6 class V0.8687new - training
D08001, Furosemide diolaminehsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8687known
D01254, Tofisopam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8687known
D07481, Azasetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8686known
D02130, Tropisetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8686known
D00722, Oxybutynin chloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8685known
D00124, Ephedrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8685known
D01785, Pirmenol hydrochloride hydrate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8685known
D01709, Loxoprofen sodium hydrate hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8684known
D02969, Aprindine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8683known
D01000, Bethanechol chloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8683known
D01785, Pirmenol hydrochloride hydrate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8683known
D08253, Naphazoline hsa:147, (RefSeq) adrenoceptor alpha 1B0.8682known
D08552, Sunitinib hsa:2321, (RefSeq) fms related receptor tyrosine kinase 10.8681known
D01303, Flunarizine hydrochloride hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.868known
D02356, Verapamil hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.868known
D00782, Procyclidine hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8679known
D08220, Midodrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8678known
D02212, Ipratropium bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8677known
D00331, Furosemide hsa:6557, (RefSeq) solute carrier family 12 member 10.8677known
D00759, Cisatracurium besylate hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.8677known
D07624, Carteolol hsa:153, (RefSeq) adrenoceptor beta 10.8676known
D02247, Biperiden lactate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8675known
D00138, Scopolamine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8675known
D00477, Procainamide hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8674known
D00540, Glycopyrrolate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8674known
D00677, Granisetron hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8674known
D07838, Dihydroergotamine tartratehsa:147, (RefSeq) adrenoceptor alpha 1B0.8674known
D08140, Lofepramine hsa:6532, (RefSeq) solute carrier family 6 member 40.8674known
D08216, Mianserin hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8673known
D00738, Mepivacaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8673known
D08903, Dexlansoprazole hsa:496, (RefSeq) ATPase H+/K+ transporting subunit beta0.8672known
D07465, Arotinolol hsa:147, (RefSeq) adrenoceptor alpha 1B0.8672known
D00700, Mephobarbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8672known
D08458, Quinidine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8672known
D02969, Aprindine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8672known
D00701, Phenobarbital sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8672known
D01952, L-Methylephedrine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8671known
D02109, dl-Methylephedrine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8671known
D01025, Levobunolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8671known
D00485, Pseudoephedrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.867known
D07818, Diclofenac hydroxyethylpyrrolidinehsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8669known
D01744, Brotizolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8669known
D08903, Dexlansoprazole hsa:495, (RefSeq) ATPase H+/K+ transporting subunit alpha0.8669known
D00619, Verapamil hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8669known
D08690, Zolpidem hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8669known
D04257, Fospropofol disodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8668known
D01307, Midodrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8667known
D00559, Pramipexole dihydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8667known
D00631, Bepridil hydrochloride hsa:3752, (RefSeq) potassium voltage-gated channel subfamily D member 30.8667known
D00791, Fluphenazine hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8667known
D00738, Mepivacaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8666known
D01119, Temocapril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8666known
D00996, Epinephrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8665known
D09789, Kirenidipine hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8664known
D00472, Prednisolone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8664known
D02983, Argipressin tannate hsa:554, (RefSeq) arginine vasopressin receptor 20.8663known
D00335, Glipizide hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.8662known
D00403, Methotrimeprazine hsa:1813, (RefSeq) dopamine receptor D20.866known
D02624, Eszopiclone hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.866known
D07867, Dolasetron hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8659known
D00624, Perindopril erbumine hsa:1636, (RefSeq) angiotensin I converting enzyme0.8659known
D00442, Octreotide hsa:6753, (RefSeq) somatostatin receptor 30.8658known
D07099, Cimetropium bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8658known
D01205, Dexmedetomidine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8658known
D00270, Chlorpromazine hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8658known
D07409, Pentetrazol hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8657known
D08001, Furosemide diolaminehsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8655known
D08216, Mianserin hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8655known
D07552, Bupivacaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8655new - training
D07520, Bepridil hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8655known
D04257, Fospropofol disodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8654known
D02246, Biperiden hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8654known
D00609, Prazosin hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8654known
D02247, Biperiden lactate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8653known
D00619, Verapamil hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8653known
D08524, Sorafenib hsa:3791, (RefSeq) kinase insert domain receptor0.8653known
D01201, Tiemonium iodide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8652known
D08322, Oxymetazoline hsa:147, (RefSeq) adrenoceptor alpha 1B0.8652known
D06104, Theophylline sodium glycinate hsa:135, (RefSeq) adenosine A2a receptor0.8651known
D08690, Zolpidem hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.865known
D02041, Tropisetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8649known
D05478, Pilocarpine nitrate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8649known
D07442, Ambroxol hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8648known
D01455, Cifenline succinate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8648known
D08116, Levobupivacaine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8648new - training
D01712, Theophylline sodium acetate hsa:135, (RefSeq) adenosine A2a receptor0.8647known
D00740, Procaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8647known
D00361, Liotrix hsa:7067, (RefSeq) thyroid hormone receptor alpha0.8646known
D08066, Imatinib hsa:3815, (RefSeq) KIT proto-oncogene0.8646known
D02206, Buformin hydrochloride hsa:5563, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 20.8645known
D00636, Amiodarone hydrochloride hsa:3760, (RefSeq) potassium inwardly rectifying channel subfamily J member 30.8645known
D04970, Methacholine chloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8645known
D08048, Hydroquinidine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8644known
D00458, Quetiapine fumarate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8644known
D00983, Triamcinolone acetonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8643known
D00678, Ondansetron hydrochloride hydrate hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8643known
D04034, Chlorpromazine phenolphthalinate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8643known
D07520, Bepridil hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8643known
D01278, Oxazolam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8642known
D00631, Bepridil hydrochloride hsa:3760, (RefSeq) potassium inwardly rectifying channel subfamily J member 30.8642known
D07999, Sodium furosemidehsa:6557, (RefSeq) solute carrier family 12 member 10.8641known
D08284, Norepinephrine hydrochoridehsa:151, (RefSeq) adrenoceptor alpha 2B0.8641known
D01553, Manidipine hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8641known
D01767, Tenoxicam hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8641known
D07409, Pentetrazol hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.864known
D00721, Methanthelinium bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.864known
D08691, Zuclopenthixol acetatehsa:1813, (RefSeq) dopamine receptor D20.864known
D02206, Buformin hydrochloride hsa:5562, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 10.864known
D00442, Octreotide hsa:6754, (RefSeq) somatostatin receptor 40.8639known
D02247, Biperiden lactate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8639known
D00537, Topiramate hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8638known
D04970, Methacholine chloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8638known
D01103, Trospium chloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8637known
D01245, Bromazepam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8637known
D08411, Prazosin hsa:147, (RefSeq) adrenoceptor alpha 1B0.8636known
D09789, Kirenidipine hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8636known
D08662, Urapidil hydrochloridehsa:148, (RefSeq) adrenoceptor alpha 1A0.8636known
D00483, Propranolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8636known
D00719, Hyoscyamine sulfate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8636known
D04257, Fospropofol disodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8635known
D07461, Apraclonidine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8635known
D00610, Terazosin hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8635known
D00619, Verapamil hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8634known
D06103, Theophylline hsa:135, (RefSeq) adenosine A2a receptor0.8634known
D02995, Asenapine maleate hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8634known
D07718, Clocapramine hsa:1813, (RefSeq) dopamine receptor D20.8634known
D06495, Octreotide acetate hsa:6755, (RefSeq) somatostatin receptor 50.8633known
D05343, Palonosetron hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8633known
D02200, Pilocarpine hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8633known
D00477, Procainamide hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8633known
D01254, Tofisopam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8632known
D01163, Ergonovine maleate hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.8632known
D00637, Disopyramide phosphate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8631known
D00477, Procainamide hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8631known
D08693, Zuclopenthixol dihydrochloridehsa:1813, (RefSeq) dopamine receptor D20.8631known
D07203, Methylprednisolone aceponate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.863known
D02149, Epinephrine bitartrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.863known
D04257, Fospropofol disodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8629known
D08425, Procyclidine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8629known
D09032, Vinflunine ditartrate hsa:347688, (RefSeq) tubulin beta 8 class VIII0.8628new - training
D03776, Zofenoprilat arginine hsa:1636, (RefSeq) angiotensin I converting enzyme0.8628known
D02250, Octreotide acetate hsa:6755, (RefSeq) somatostatin receptor 50.8628known
D06413, Nilotinib hydrochloride hydrate hsa:3815, (RefSeq) KIT proto-oncogene0.8628known
D00456, Ondansetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8628known
D01785, Pirmenol hydrochloride hydrate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8627known
D01691, Nipradilol hsa:153, (RefSeq) adrenoceptor beta 10.8627known
D07540, Brimonidine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8627known
D00428, Salsalate hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8627known
D06495, Octreotide acetate hsa:6752, (RefSeq) somatostatin receptor 20.8626known
D08035, Haloperidol lactatehsa:1813, (RefSeq) dopamine receptor D20.8626known
D08116, Levobupivacaine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8626new - training
D08068, Imidapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8625known
D03753, Perindopril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8625known
D00361, Liotrix hsa:7068, (RefSeq) thyroid hormone receptor beta0.8624known
D04257, Fospropofol disodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8624known
D00593, Glimepiride hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.8623known
D01501, Isoniazid calcium pyruvinate hsa:4128, (RefSeq) monoamine oxidase A0.8623known
D04257, Fospropofol disodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8622known
D02070, Homatropine methylbromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8622known
D04257, Fospropofol disodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8622known
D07905, Ergometrine hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.8622known
D07175, Palonosetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8621known
D05343, Palonosetron hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8621known
D07520, Bepridil hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.862known
D02250, Octreotide acetate hsa:6752, (RefSeq) somatostatin receptor 20.862known
D00481, Propantheline bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8619known
D02253, Pentobarbital calcium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8619known
D06678, Motesanib hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8618known
D07442, Ambroxol hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8617known
D09789, Kirenidipine hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8617known
D08027, Gonadorelin hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8617known
D02356, Verapamil hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8616known
D08125, Levothyroxine hsa:7067, (RefSeq) thyroid hormone receptor alpha0.8615known
D06272, Sorafenib tosylate hsa:3791, (RefSeq) kinase insert domain receptor0.8615known
D00267, Chlordiazepoxide hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8614known
D00076, Noradrenaline hsa:148, (RefSeq) adrenoceptor alpha 1A0.8614known
D00701, Phenobarbital sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8613known
D07442, Ambroxol hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8613known
D08049, Hydroquinidine hydrochloridehsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8613new - training
D00946, Diethylstilbestrol diphosphate hsa:2099, (RefSeq) estrogen receptor 10.8612known
D00980, Prednisolone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8612known
D00792, Fluphenazine enanthate hsa:1813, (RefSeq) dopamine receptor D20.8611known
D01358, Mianserin hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8611known
D02281, Levalbuterol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8611known
D04970, Methacholine chloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.861known
D07175, Palonosetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8609known
D02105, Tetracosactide acetate hsa:4160, (RefSeq) melanocortin 4 receptor0.8608known
D00967, Toremifene citrate hsa:2099, (RefSeq) estrogen receptor 10.8608known
D08425, Procyclidine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8608known
D01061, Irinotecan hydrochloride hsa:7150, (RefSeq) DNA topoisomerase I0.8607known
D02105, Tetracosactide acetate hsa:4159, (RefSeq) melanocortin 3 receptor0.8607known
D00375, Mephenytoin hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8606known
D00428, Salsalate hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8606known
D07552, Bupivacaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8606new - training
D04257, Fospropofol disodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8605known
D08001, Furosemide diolaminehsa:6557, (RefSeq) solute carrier family 12 member 10.8605known
D07442, Ambroxol hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8604known
D00756, Tetrahydrozoline nitrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8604known
D01022, Oxymetazoline hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8604known
D00946, Diethylstilbestrol diphosphate hsa:2100, (RefSeq) estrogen receptor 20.8603known
D07465, Arotinolol hsa:148, (RefSeq) adrenoceptor alpha 1A0.8602known
D00959, Testosterone propionate hsa:367, (RefSeq) androgen receptor0.86known
D00477, Procainamide hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8599known
D04257, Fospropofol disodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8599known
D00967, Toremifene citrate hsa:2100, (RefSeq) estrogen receptor 20.8598known
D01887, Bunazosin hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8598known
D07826, Hexestrol diphosphate sodiumhsa:2099, (RefSeq) estrogen receptor 10.8598known
D07552, Bupivacaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8598new - training
D00095, Epinephrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8598known
D07550, Bunazosin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8597known
D05008, Metoclopramide hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8597known
D00267, Chlordiazepoxide hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8597known
D00491, Paclitaxel hsa:81027, (RefSeq) tubulin beta 1 class VI0.8596known
D08206, Methylephedrine hsa:155, (RefSeq) adrenoceptor beta 30.8596known
D01287, Levobupivacaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8593known
D08690, Zolpidem hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8593known
D00776, Tizanidine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8593known
D01201, Tiemonium iodide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8592known
D08125, Levothyroxine hsa:7068, (RefSeq) thyroid hormone receptor beta0.8592known
D02357, Methysergide hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.8592known
D01163, Ergonovine maleate hsa:152, (RefSeq) adrenoceptor alpha 2C0.8591known
D01201, Tiemonium iodide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.859known
D01165, Piperidolate hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.859known
D00491, Paclitaxel hsa:10381, (RefSeq) tubulin beta 3 class III0.859known
D07826, Hexestrol diphosphate sodiumhsa:2100, (RefSeq) estrogen receptor 20.8589known
D00779, Biperiden hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8588known
D00538, Zonisamide hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8587known
D02071, Scopolamine hydrobromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8587known
D07595, Fosphenytoin sodium hydrate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8585known
D01023, Tetrahydrozoline hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8584known
D01946, Oxitropium bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8582known
D00759, Cisatracurium besylate hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.8581known
D08456, Quetiapine hsa:1813, (RefSeq) dopamine receptor D20.858known
D07409, Pentetrazol hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8579known
D00235, Atenolol hsa:153, (RefSeq) adrenoceptor beta 10.8579known
D00382, Torsemide hsa:6557, (RefSeq) solute carrier family 12 member 10.8578known
D00151, Mefenamic acid hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8578known
D02213, Metoclopramide hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8578known
D00979, Methylprednisolone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8578known
D00789, Chlorpromazine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8578known
D00537, Topiramate hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8577known
D01000, Bethanechol chloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8577known
D01767, Tenoxicam hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8577known
D01165, Piperidolate hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8577known
D00996, Epinephrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8577known
D01952, L-Methylephedrine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8575known
D02109, dl-Methylephedrine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8575known
D00638, Flecainide acetate hsa:3757, (RefSeq) potassium voltage-gated channel subfamily H member 20.8575known
D08595, Tiemonium methylsulfatehsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8575known
D00710, Valproate sodium hsa:18, (RefSeq) 4-aminobutyrate aminotransferase0.8574known
D00325, Fluocinonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8573known
D00270, Chlorpromazine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8573known
D08459, Quinidine phenylethylbarbituratehsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8573known
D01307, Midodrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8573known
D08600, Timolol hsa:153, (RefSeq) adrenoceptor beta 10.8572known
D01632, Dexamethasone dipropionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8571known
D08220, Midodrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8571known
D00442, Octreotide hsa:6755, (RefSeq) somatostatin receptor 50.8571known
D00619, Verapamil hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.857known
D07838, Dihydroergotamine tartratehsa:148, (RefSeq) adrenoceptor alpha 1A0.857known
D00124, Ephedrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8569known
D01133, Pimobendan hsa:5140, (RefSeq) phosphodiesterase 3B0.8568known
D07905, Ergometrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8568known
D02537, Dronedarone hsa:147, (RefSeq) adrenoceptor alpha 1B0.8567known
D00442, Octreotide hsa:6752, (RefSeq) somatostatin receptor 20.8567known
D07802, Dexamethasone phosphatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8566known
D08339, Pergolide hsa:1813, (RefSeq) dopamine receptor D20.8565known
D02995, Asenapine maleate hsa:3355, (RefSeq) 5-hydroxytryptamine receptor 1F0.8565known
D00378, Timolol hsa:153, (RefSeq) adrenoceptor beta 10.8564known
D00199, Ajmaline hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8564known
D02105, Tetracosactide acetate hsa:4161, (RefSeq) melanocortin 5 receptor0.8563known
D08422, Procaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8563new - training
D00712, Methohexital sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8563new - training
D03274, Chlorpromazine hibenzate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8562known
D02430, Gliquidone hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.8561known
D08382, Piperidolate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8561known
D00485, Pseudoephedrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8561known
D07124, Alfuzosin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8559known
D08566, Temocapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8559known
D00349, Isradipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8558known
D00331, Furosemide hsa:6558, (RefSeq) solute carrier family 12 member 20.8558known
D08090, Isoprenaline hsa:154, (RefSeq) adrenoceptor beta 20.8558known
D08397, Pizotifen malatehsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8558known
D00076, Noradrenaline hsa:151, (RefSeq) adrenoceptor alpha 2B0.8558known
D01304, Amezinium metilsulfate hsa:4129, (RefSeq) monoamine oxidase B0.8558known
D00151, Mefenamic acid hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8558known
D09789, Kirenidipine hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8557known
D02591, Dexamethasone acefurate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8557known
D00358, Lidocaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8557known
D00789, Chlorpromazine hydrochloride hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8556known
D08365, Phenylephrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8556known
D03301, Prednisolone valerate acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8556known
D08614, Tolazoline hsa:146, (RefSeq) adrenoceptor alpha 1D0.8556known
D00371, Theophylline hsa:135, (RefSeq) adenosine A2a receptor0.8555known
D00733, Dibucaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8555known
D00303, Disopyramide hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8555known
D01254, Tofisopam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8555known
D07874, Doxazosin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8554known
D08415, Prednisolone steaglate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8554known
D02017, Oxtriphylline hsa:135, (RefSeq) adenosine A2a receptor0.8552known
D00889, Cerivastatin sodium hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8552known
D08206, Methylephedrine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8552known
D00459, Quinapril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8551known
D00130, Diflunisal hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8551known
D01245, Bromazepam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8551known
D00799, Trifluoperazine hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8551known
D01044, Flupentixol hsa:1813, (RefSeq) dopamine receptor D20.855known
D09989, Vardenafil hydrochloride hsa:8654, (RefSeq) phosphodiesterase 5A0.855known
D00330, Flurbiprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.855known
D08207, Methylergometrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8549known
D05000, Methylprednisolone hemisuccinate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8548known
D08466, Ramosetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8547known
D01948, Dexamethasone valerate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8546known
D00270, Chlorpromazine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8546known
D00999, Acetylcholine chloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8546known
D00944, Metformin hydrochloride hsa:5563, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 20.8546known
D01175, Carpronium chloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8545known
D08284, Norepinephrine hydrochoridehsa:150, (RefSeq) adrenoceptor alpha 2A0.8543known
D00701, Phenobarbital sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8543known
D00563, Mirtazapine hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8543known
D00680, Methylergonovine maleate hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.8543known
D08435, Propafenone hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8543known
D04257, Fospropofol disodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8543known
D00451, Sumatriptan hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8542known
D00944, Metformin hydrochloride hsa:5562, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 10.8542known
D01133, Pimobendan hsa:5139, (RefSeq) phosphodiesterase 3A0.8542known
D00252, Carbamazepine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8542known
D03274, Chlorpromazine hibenzate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8541known
D02430, Gliquidone hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.854known
D05024, Mibefradil dihydrochloride hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.854known
D08421, Procainamide hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8539known
D00267, Chlordiazepoxide hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8539known
D08412, Prednisolone pivalatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8539known
D08121, Levomethadone hsa:2902, (RefSeq) glutamate ionotropic receptor NMDA type subunit 10.8539known
D08066, Imatinib hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8539known
D08426, Profenamine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8539known
D07797, Dexamethasone isonicotinatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8538known
D08216, Mianserin hsa:151, (RefSeq) adrenoceptor alpha 2B0.8538known
D01254, Tofisopam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8537known
D00270, Chlorpromazine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8536known
D03752, Quinapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8536known
D01613, Azasetron hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8536known
D00722, Oxybutynin chloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8536known
D06495, Octreotide acetate hsa:6751, (RefSeq) somatostatin receptor 10.8536known
D07796, Dexamethasone 21-acetatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8535known
D02066, Isoproterenol sulfate hsa:154, (RefSeq) adrenoceptor beta 20.8535known
D00681, Methysergide maleate hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.8535known
D08413, Prednisolone sodium metazoate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8535known
D01253, Clobazam hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8535known
D05002, Methylprednisolone suleptanate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8534known
D04496, Idoxifene hsa:2099, (RefSeq) estrogen receptor 10.8534known
D02235, Desmopressin acetate hsa:554, (RefSeq) arginine vasopressin receptor 20.8533known
D00538, Zonisamide hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8533known
D02174, Dexamethasone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8533known
D07312, Levosulpiride hsa:1813, (RefSeq) dopamine receptor D20.8533known
D01000, Bethanechol chloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8533known
D00997, Tolazoline hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8532known
D00076, Noradrenaline hsa:146, (RefSeq) adrenoceptor alpha 1D0.8531known
D08216, Mianserin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8531known
D00631, Bepridil hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8531known
D00608, Doxazosin mesylate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8531known
D00699, Butabarbital sodium hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8531new - training
D00349, Isradipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8531known
D02247, Biperiden lactate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.853known
D00540, Glycopyrrolate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.853known
D00124, Ephedrine hsa:151, (RefSeq) adrenoceptor alpha 2B0.853known
D07962, Flecainide hsa:3757, (RefSeq) potassium voltage-gated channel subfamily H member 20.853known
D02250, Octreotide acetate hsa:6751, (RefSeq) somatostatin receptor 10.8529known
D00560, Pimozide hsa:1813, (RefSeq) dopamine receptor D20.8529known
D00725, Dolasetron mesylate hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8528known
D08667, Calcium valproatehsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8528known
D07727, Clomipramine hsa:6532, (RefSeq) solute carrier family 6 member 40.8528known
D04257, Fospropofol disodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8527known
D03180, Butabarbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8527new - training
D00562, Propylthiouracil hsa:7173, (RefSeq) thyroid peroxidase0.8527known
D00982, Prednisolone tebutate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8527known
D01806, Oxprenolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8526known
D08206, Methylephedrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8526known
D00599, Carteolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8526known
D01998, Prednisolone farnesylate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8526known
D00701, Phenobarbital sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8525known
D02156, Prednisolone hemisuccinate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8525known
D08414, Prednisolone 21-hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8525known
D04034, Chlorpromazine phenolphthalinate hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8524known
D06413, Nilotinib hydrochloride hydrate hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8524known
D04496, Idoxifene hsa:2100, (RefSeq) estrogen receptor 20.8524known
D01615, Dexamethasone palmitate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8524known
D07999, Sodium furosemidehsa:6558, (RefSeq) solute carrier family 12 member 20.8524known
D07799, Dexamethasone 21-tebutatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8524known
D01886, Hydrocortisone probutate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8523known
D06414, Dasatinib hsa:6714, (RefSeq) SRC proto-oncogene0.8522known
D00636, Amiodarone hydrochloride hsa:3767, (RefSeq) potassium inwardly rectifying channel subfamily J member 110.8522known
D01510, Dexamethasone metasulfobenzoate sodium hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8522known
D00712, Methohexital sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8522new - training
D08662, Urapidil hydrochloridehsa:147, (RefSeq) adrenoceptor alpha 1B0.8522known
D01613, Azasetron hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8521known
D08569, Terazosin hsa:146, (RefSeq) adrenoceptor alpha 1D0.852known
D09752, Carpronium chloride hydrate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.852known
D00776, Tizanidine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.852known
D00712, Methohexital sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.852new - training
D01253, Clobazam hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.852known
D07495, Beclometasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8517known
D08667, Calcium valproatehsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8517known
D01952, L-Methylephedrine hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8517known
D02109, dl-Methylephedrine hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8517known
D07129, Alosetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8517known
D07801, Dexamethasone phenylpropionatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8517known
D02016, Ramosetron hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8517known
D00679, Ergotamine tartrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8516known
D08435, Propafenone hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8515known
D07800, Dexamethasone 21-valeratehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8515known
D00981, Prednisolone sodium phosphate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8513known
D02592, Dexamethasone beloxil hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8513known
D00349, Isradipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8512known
D00668, Dexchlorpheniramine maleate hsa:3269, (RefSeq) histamine receptor H10.8511known
D00999, Acetylcholine chloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8511known
D07409, Pentetrazol hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.851known
D01239, Prednisolone sodium succinate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.851known
D00640, Propafenone hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.851known
D03180, Butabarbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.851new - training
D00740, Procaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.851known
D00291, Desmopressin hsa:554, (RefSeq) arginine vasopressin receptor 20.8509known
D00252, Carbamazepine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8508known
D02969, Aprindine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8508known
D02580, Isocarboxazid hsa:4129, (RefSeq) monoamine oxidase B0.8508known
D00793, Fluphenazine decanoate hsa:1813, (RefSeq) dopamine receptor D20.8507known
D08690, Zolpidem hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8507known
D00165, Hydrocortisone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8507known
D00782, Procyclidine hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8507known
D02149, Epinephrine bitartrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8506known
D01600, Diphenylpiperidinomethyldioxolan iodide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8505known
D00252, Carbamazepine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8504known
D00537, Topiramate hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8504known
D07867, Dolasetron hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.8504known
D01479, Ambroxol hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8503known
D01547, Zaltoprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8503known
D00975, Dexamethasone sodium phosphate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8502known
D02212, Ipratropium bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8502known
D00712, Methohexital sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8501new - training
D01253, Clobazam hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8501known
D08425, Procyclidine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8501known
D08435, Propafenone hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.85known
D00378, Timolol hsa:154, (RefSeq) adrenoceptor beta 20.85known
D08600, Timolol hsa:154, (RefSeq) adrenoceptor beta 20.85known
D01600, Diphenylpiperidinomethyldioxolan iodide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.85known
D01022, Oxymetazoline hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8499known
D00252, Carbamazepine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8499known
D00699, Butabarbital sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8499new - training
D05001, Methylprednisolone sodium phosphate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8498known
D01667, Delapril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8498known
D00354, Lamotrigine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8497known
D02537, Dronedarone hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8497known
D09794, Norepinephrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8497known
D08614, Tolazoline hsa:152, (RefSeq) adrenoceptor alpha 2C0.8496known
D01806, Oxprenolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8496known
D01272, Clobetasol propionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8496known
D01573, Etilefrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8496known
D01253, Clobazam hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8496known
D00502, Pergolide mesylate hsa:1813, (RefSeq) dopamine receptor D20.8495known
D02829, Alosetron hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8495known
D08216, Mianserin hsa:3354, (RefSeq) 5-hydroxytryptamine receptor 1E0.8494known
D01929, Tiotropium bromide hydrate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8494known
D07465, Arotinolol hsa:146, (RefSeq) adrenoceptor alpha 1D0.8493known
D00330, Flurbiprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8493known
D04970, Methacholine chloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8493known
D04370, Granisetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8493known
D07409, Pentetrazol hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8493known
D08341, Perphenazine decanoatehsa:1813, (RefSeq) dopamine receptor D20.8492known
D03180, Butabarbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8492new - training
D02910, Amiodarone hsa:147, (RefSeq) adrenoceptor alpha 1B0.8492known
D00712, Methohexital sodium hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8492new - training
D08435, Propafenone hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.849known
D01253, Clobazam hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.849known
D07099, Cimetropium bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.849known
D01253, Clobazam hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.849known
D02408, Trimipramine maleate hsa:6532, (RefSeq) solute carrier family 6 member 40.849known
D00680, Methylergonovine maleate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8489known
D08001, Furosemide diolaminehsa:6558, (RefSeq) solute carrier family 12 member 20.8489known
D00138, Scopolamine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8489known
D03180, Butabarbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8489new - training
D01253, Clobazam hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8489known
D08048, Hydroquinidine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8488known
D08207, Methylergometrine hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.8488known
D01600, Diphenylpiperidinomethyldioxolan iodide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8488known
D01547, Zaltoprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8488known
D02130, Tropisetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8487known
D02246, Biperiden hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8486known
D02374, Metipranolol hsa:153, (RefSeq) adrenoceptor beta 10.8486known
D00782, Procyclidine hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8485known
D07269, Dexketoprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8485known
D00699, Butabarbital sodium hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8485new - training
D07550, Bunazosin hsa:147, (RefSeq) adrenoceptor alpha 1B0.8485known
D00577, Diethylstilbestrol hsa:2099, (RefSeq) estrogen receptor 10.8484known
D04157, Fenoterol hsa:154, (RefSeq) adrenoceptor beta 20.8484known
D07999, Sodium furosemidehsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8484known
D01358, Mianserin hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8484known
D00699, Butabarbital sodium hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8484new - training
D02288, Hydrocortisone valerate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8483known
D00759, Cisatracurium besylate hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.8483known
D01023, Tetrahydrozoline hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8483known
D01830, Arotinolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8483known
D02086, Lidocaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8483known
D00699, Butabarbital sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8482new - training
D00442, Octreotide hsa:6751, (RefSeq) somatostatin receptor 10.8482known
D00095, Epinephrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8482known
D04370, Granisetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8481known
D07798, Dexamethasone sodium hemisulfatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8481known
D02208, Sultopride hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.848known
D01254, Tofisopam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.848known
D01021, Naphazoline nitrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.848known
D07781, Delapril hsa:1636, (RefSeq) angiotensin I converting enzyme0.848known
D00631, Bepridil hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.848known
D07704, Citalopram hsa:6532, (RefSeq) solute carrier family 6 member 40.8479known
D01201, Tiemonium iodide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8479known
D01165, Piperidolate hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8478known
D03556, Zuclopenthixol hsa:1813, (RefSeq) dopamine receptor D20.8478known
D00997, Tolazoline hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8477known
D00766, Succinylcholine chloride hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.8477known
D06247, Triptorelin hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8476known
D00577, Diethylstilbestrol hsa:2100, (RefSeq) estrogen receptor 20.8476known
D03180, Butabarbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8474new - training
D00819, Nefazodone hydrochloride hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8474known
D00826, Tranylcypromine sulfate hsa:4129, (RefSeq) monoamine oxidase B0.8474known
D00721, Methanthelinium bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8474known
D04966, Metformin hsa:5563, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 20.8473known
D01253, Clobazam hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8473known
D00076, Noradrenaline hsa:150, (RefSeq) adrenoceptor alpha 2A0.8472known
D00640, Propafenone hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8472known
D04257, Fospropofol disodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8472known
D01333, Urapidil hsa:148, (RefSeq) adrenoceptor alpha 1A0.8472known
D00631, Bepridil hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8471known
D00246, Budesonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8471known
D01410, Benzydamine hydrochloride hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8471known
D00712, Methohexital sodium hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8471new - training
D00537, Topiramate hsa:2891, (RefSeq) glutamate ionotropic receptor AMPA type subunit 20.8471known
D03715, Dexibuprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8471known
D01785, Pirmenol hydrochloride hydrate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.847known
D02756, Aclarubicin hsa:7150, (RefSeq) DNA topoisomerase I0.847known
D07259, Buserelin hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.847known
D00270, Chlorpromazine hsa:150, (RefSeq) adrenoceptor alpha 2A0.847known
D07906, Ergotamine hsa:147, (RefSeq) adrenoceptor alpha 1B0.847known
D02076, Brimonidine tartrate hsa:151, (RefSeq) adrenoceptor alpha 2B0.847known
D00699, Butabarbital sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8469new - training
D04966, Metformin hsa:5562, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 10.8469known
D06396, Renzapride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8469known
D08516, Sitagliptin hsa:1803, (RefSeq) dipeptidyl peptidase 40.8468known
D00701, Phenobarbital sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8468known
D08625, Tranylcypromine hsa:4129, (RefSeq) monoamine oxidase B0.8467known
D00699, Butabarbital sodium hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8467new - training
D00712, Methohexital sodium hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8466new - training
D00382, Torsemide hsa:6558, (RefSeq) solute carrier family 12 member 20.8466known
D01253, Clobazam hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8465known
D03274, Chlorpromazine hibenzate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8465known
D00463, Oxaprozin hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8464known
D00699, Butabarbital sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8464new - training
D02248, Levomepromazine maleate hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8464known
D01358, Mianserin hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8464known
D01386, Ephedrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8463known
D07931, Etilefrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8463known
D00640, Propafenone hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8463known
D07465, Arotinolol hsa:155, (RefSeq) adrenoceptor beta 30.8461known
D00712, Methohexital sodium hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8461new - training
D02537, Dronedarone hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8461known
D07124, Alfuzosin hsa:147, (RefSeq) adrenoceptor alpha 1B0.846known
D03180, Butabarbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.846new - training
D08524, Sorafenib hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.846known
D00354, Lamotrigine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.846known
D08216, Mianserin hsa:150, (RefSeq) adrenoceptor alpha 2A0.8459known
D05429, Aminophylline hydrate hsa:5140, (RefSeq) phosphodiesterase 3B0.8459known
D08206, Methylephedrine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8458known
D01000, Bethanechol chloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8458known
D01830, Arotinolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8458known
D00537, Topiramate hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8458known
D07905, Ergometrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8457known
D08064, Ifenprodil hsa:148, (RefSeq) adrenoceptor alpha 1A0.8457known
D08216, Mianserin hsa:146, (RefSeq) adrenoceptor alpha 1D0.8457known
D01358, Mianserin hydrochloride hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8457known
D00270, Chlorpromazine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8456known
D01163, Ergonovine maleate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8456known
D00485, Pseudoephedrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8456known
D00281, Clonidine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8456known
D00999, Acetylcholine chloride hsa:1141, (RefSeq) cholinergic receptor nicotinic beta 2 subunit0.8456known
D00354, Lamotrigine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8456known
D00640, Propafenone hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8455known
D01303, Flunarizine hydrochloride hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8455known
D08207, Methylergometrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8455known
D03696, Desonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8454known
D08217, Mibefradil hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8454known
D07481, Azasetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8454known
D08085, Iproniazid phosphatehsa:4129, (RefSeq) monoamine oxidase B0.8454known
D00726, Metoclopramide hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8453known
D00349, Isradipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8453known
D01103, Trospium chloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8453known
D01303, Flunarizine hydrochloride hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8453known
D00267, Chlordiazepoxide hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8453known
D08284, Norepinephrine hydrochoridehsa:153, (RefSeq) adrenoceptor beta 10.8453known
D00620, Benazepril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8453known
D01011, Liothyronine sodium hsa:7067, (RefSeq) thyroid hormone receptor alpha0.8452known
D07874, Doxazosin hsa:147, (RefSeq) adrenoceptor alpha 1B0.8452known
D08600, Timolol hsa:155, (RefSeq) adrenoceptor beta 30.8451known
D00481, Propantheline bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8451known
D00537, Topiramate hsa:2898, (RefSeq) glutamate ionotropic receptor kainate type subunit 20.8451known
D08122, Levomethadone hydrochloridehsa:2902, (RefSeq) glutamate ionotropic receptor NMDA type subunit 10.8451known
D03715, Dexibuprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.845known
D00479, Prochlorperazine maleate hsa:1813, (RefSeq) dopamine receptor D20.845known
D00130, Diflunisal hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.845known
D00537, Topiramate hsa:2893, (RefSeq) glutamate ionotropic receptor AMPA type subunit 40.845known
D02070, Homatropine methylbromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8449known
D01599, Gliclazide hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.8449known
D01019, Metaraminol bitartrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8448known
D02041, Tropisetron hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8448known
D00789, Chlorpromazine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.8447known
D02258, Atorvastatin calcium hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8447known
D00699, Butabarbital sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8447new - training
D00631, Bepridil hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8446known
D00514, Dexmedetomidine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8446known
D00378, Timolol hsa:155, (RefSeq) adrenoceptor beta 30.8446known
D00493, Prochlorperazine hsa:1813, (RefSeq) dopamine receptor D20.8446known
D02537, Dronedarone hsa:148, (RefSeq) adrenoceptor alpha 1A0.8445known
D00540, Glycopyrrolate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8445known
D00331, Furosemide hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8445known
D07481, Azasetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8444known
D00635, Metoprolol succinate hsa:153, (RefSeq) adrenoceptor beta 10.8444known
D07838, Dihydroergotamine tartratehsa:146, (RefSeq) adrenoceptor alpha 1D0.8444known
D07834, Dihydroergocristine hsa:1813, (RefSeq) dopamine receptor D20.8443new - training
D07715, Clobetasol hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8443known
D02022, Prochlorperazine mesilate hsa:1813, (RefSeq) dopamine receptor D20.8442known
D08253, Naphazoline hsa:146, (RefSeq) adrenoceptor alpha 1D0.8442known
D00712, Methohexital sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8442new - training
D01830, Arotinolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8441known
D00999, Acetylcholine chloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8441known
D01358, Mianserin hydrochloride hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8441known
D07905, Ergometrine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8441known
D00270, Chlorpromazine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.844known
D00996, Epinephrine hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.844known
D00680, Methylergonovine maleate hsa:150, (RefSeq) adrenoceptor alpha 2A0.844known
D00271, Chlorpropamide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.844known
D06876, Hydrocortisone aceponate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8439known
D00887, Atorvastatin calcium anhydoroushsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8439known
D08422, Procaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8439new - training
D01549, Imidapril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8438known
D00726, Metoclopramide hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8437known
D02537, Dronedarone hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8437known
D08624, Tramazoline hsa:148, (RefSeq) adrenoceptor alpha 1A0.8437known
D07099, Cimetropium bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8436known
D07409, Pentetrazol hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8436known
D00712, Methohexital sodium hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8436new - training
D00679, Ergotamine tartrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8435known
D05587, Practolol hsa:153, (RefSeq) adrenoceptor beta 10.8435known
D07999, Sodium furosemidehsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8434known
D01619, Hydrocortisone butyrate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8434known
D08485, Rizatriptan hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8433known
D01410, Benzydamine hydrochloride hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8433known
D07833, Dihydroergocristine mesilate hsa:1813, (RefSeq) dopamine receptor D20.8433new - training
D07474, Atorvastatin hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8433known
D07921, Estriol sodium succinate hsa:2099, (RefSeq) estrogen receptor 10.8433known
D05429, Aminophylline hydrate hsa:5139, (RefSeq) phosphodiesterase 3A0.8433known
D04375, Guanabenz hsa:151, (RefSeq) adrenoceptor alpha 2B0.8431known
D01011, Liothyronine sodium hsa:7068, (RefSeq) thyroid hormone receptor beta0.8431known
D02248, Levomepromazine maleate hsa:1813, (RefSeq) dopamine receptor D20.8431known
D00124, Ephedrine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8431known
D09032, Vinflunine ditartrate hsa:81027, (RefSeq) tubulin beta 1 class VI0.843new - training
D07971, Flunarizine hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8429known
D08216, Mianserin hsa:152, (RefSeq) adrenoceptor alpha 2C0.8429known
D01357, Betamethasone valerate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8428known
D00227, Aminophylline hsa:134, (RefSeq) adenosine A1 receptor0.8428known
D00712, Methohexital sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8428new - training
D01183, Tolfenamic acid hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8427known
D00354, Lamotrigine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8427known
D07269, Dexketoprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8426known
D08366, Phenylephrine tartratehsa:148, (RefSeq) adrenoceptor alpha 1A0.8426known
D08966, Phenylephrine bitartrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8426known
D07726, Clomifene hsa:2099, (RefSeq) estrogen receptor 10.8425known
D03718, Dexibuprofen lysine hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8425known
D01952, L-Methylephedrine hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8425known
D02109, dl-Methylephedrine hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8425known
D00477, Procainamide hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8425known
D02275, Suxamethonium chloride hydrate hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.8424known
D07921, Estriol sodium succinate hsa:2100, (RefSeq) estrogen receptor 20.8423known
D09032, Vinflunine ditartrate hsa:10381, (RefSeq) tubulin beta 3 class III0.8423new - training
D00595, Buformin hsa:5563, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 20.8423known
D08685, Yohimbine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8423known
D01273, Clobetasone butyrate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8422known
D08953, Nilotinib hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.8421known
D08113, Leuprorelin hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8421known
D08639, Trimebutine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8421known
D02149, Epinephrine bitartrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.842known
D00403, Methotrimeprazine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8419known
D08049, Hydroquinidine hydrochloridehsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8419new - training
D00595, Buformin hsa:5562, (RefSeq) protein kinase AMP-activated catalytic subunit alpha 10.8419known
D02357, Methysergide hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8418known
D08667, Calcium valproatehsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8417known
D01008, Apraclonidine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8417known
D01183, Tolfenamic acid hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8417known
D00608, Doxazosin mesylate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8417known
D06087, Testosterone undecanoate hsa:367, (RefSeq) androgen receptor0.8417known
D07726, Clomifene hsa:2100, (RefSeq) estrogen receptor 20.8417known
D08349, Phenelzine hsa:4129, (RefSeq) monoamine oxidase B0.8416known
D03180, Butabarbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8416new - training
D00644, Esmolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8415known
D07116, Alclometasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8415known
D01915, Rosuvastatin calcium hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8414known
D00699, Butabarbital sodium hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8413new - training
D00678, Ondansetron hydrochloride hydrate hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8413known
D00779, Biperiden hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8413known
D01253, Clobazam hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8411known
D07073, Dexamethasone cipecilate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.841known
D03180, Butabarbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.841new - training
D01831, Buserelin acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.841known
D07442, Ambroxol hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.841known
D04409, Halobetasol propionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8409known
D00599, Carteolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8409known
D00996, Epinephrine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8409known
D08322, Oxymetazoline hsa:146, (RefSeq) adrenoceptor alpha 1D0.8409known
D00324, Flunisolide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8407known
D00681, Methysergide maleate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8407known
D08595, Tiemonium methylsulfatehsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8406known
D08421, Procainamide hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8406known
D08511, Setiptiline hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8406known
D08001, Furosemide diolaminehsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8406known
D01019, Metaraminol bitartrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8405known
D01404, Sobuzoxane hsa:7155, (RefSeq) DNA topoisomerase II beta0.8405known
D01573, Etilefrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8405known
D07489, Bambuterol hydrochloridehsa:154, (RefSeq) adrenoceptor beta 20.8405known
D01404, Sobuzoxane hsa:7153, (RefSeq) DNA topoisomerase II alpha0.8405known
D01358, Mianserin hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8404known
D01900, Alacepril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8404known
D00120, Sulindac hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8404known
D00678, Ondansetron hydrochloride hydrate hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8402known
D00699, Butabarbital sodium hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8402new - training
D00421, Ramipril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8401known
D01025, Levobunolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8401known
D08206, Methylephedrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8401known
D08571, Terlipressin acetate hsa:554, (RefSeq) arginine vasopressin receptor 20.8399known
D00593, Glimepiride hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.8399known
D02034, Setiptiline maleate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8399known
D00456, Ondansetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8398known
D02076, Brimonidine tartrate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8398known
D03180, Butabarbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8397new - training
D08358, Phenoxybenzamine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8397known
D08411, Prazosin hsa:146, (RefSeq) adrenoceptor alpha 1D0.8397known
D04257, Fospropofol disodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8397known
D01634, Piretanide hsa:6557, (RefSeq) solute carrier family 12 member 10.8397known
D00331, Furosemide hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8396known
D07906, Ergotamine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8396known
D00465, Oxybutynin hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8396known
D00302, Dipyridamole hsa:5139, (RefSeq) phosphodiesterase 3A0.8396known
D01254, Tofisopam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8395known
D00892, Fluvastatin sodium hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8395known
D00385, Triamcinolone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8395known
D01327, Diflorasone diacetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8395known
D01578, Pranoprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8394known
D01253, Clobazam hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8394known
D00643, Quinidine polygalacturonatehsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8393known
D07791, Desipramine hsa:6532, (RefSeq) solute carrier family 6 member 40.8392known
D00610, Terazosin hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8392known
D08049, Hydroquinidine hydrochloridehsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8391new - training
D02910, Amiodarone hsa:3752, (RefSeq) potassium voltage-gated channel subfamily D member 30.8391known
D00513, Pindolol hsa:153, (RefSeq) adrenoceptor beta 10.839known
D07905, Ergometrine hsa:150, (RefSeq) adrenoceptor alpha 2A0.839known
D02535, Timepidium bromide hydrate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.839known
D08573, Testosterone decanoatehsa:367, (RefSeq) androgen receptor0.8389known
D08249, Naloxone hsa:4986, (RefSeq) opioid receptor kappa 10.8389known
D00977, Hydrocortisone sodium phosphate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8389known
D00095, Epinephrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8388known
D01103, Trospium chloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8388known
D02537, Dronedarone hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8387known
D04720, Levosimendan hsa:5140, (RefSeq) phosphodiesterase 3B0.8387known
D08049, Hydroquinidine hydrochloridehsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8387new - training
D07465, Arotinolol hsa:153, (RefSeq) adrenoceptor beta 10.8387known
D08257, Nefazodone hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8386known
D00281, Clonidine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8386known
D00456, Ondansetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8386known
D00766, Succinylcholine chloride hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.8386known
D01382, Metharbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8386new - training
D08639, Trimebutine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8386known
D01600, Diphenylpiperidinomethyldioxolan iodide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8385known
D04531, Indoramin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8384known
D05206, Norepinephrine bitartrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8384known
D00701, Phenobarbital sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8384known
D01442, Hydrocortisone succinate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8382known
D08574, Testosterone phenylpropionatehsa:367, (RefSeq) androgen receptor0.8382known
D00787, Trihexyphenidyl hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8381known
D08064, Ifenprodil hsa:147, (RefSeq) adrenoceptor alpha 1B0.8381known
D00688, Terbutaline sulfate hsa:154, (RefSeq) adrenoceptor beta 20.8381known
D04467, Hydrocortisone hemisuccinate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.838known
D04257, Fospropofol disodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.838known
D00403, Methotrimeprazine hsa:147, (RefSeq) adrenoceptor alpha 1B0.838known
D00524, Carbachol hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8379known
D00782, Procyclidine hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8379known
D01021, Naphazoline nitrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8378known
D08639, Trimebutine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8377known
D00538, Zonisamide hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8377known
D01326, Aprindine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8377known
D06086, Testosterone phenylacetate hsa:367, (RefSeq) androgen receptor0.8376known
D08206, Methylephedrine hsa:153, (RefSeq) adrenoceptor beta 10.8376known
D02537, Dronedarone hsa:146, (RefSeq) adrenoceptor alpha 1D0.8375known
D02983, Argipressin tannate hsa:553, (RefSeq) arginine vasopressin receptor 1B0.8375known
D01578, Pranoprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8375known
D01205, Dexmedetomidine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8374known
D02995, Asenapine maleate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8374known
D00199, Ajmaline hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8373known
D08049, Hydroquinidine hydrochloridehsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8372new - training
D07958, Fexofenadine hsa:3269, (RefSeq) histamine receptor H10.8371known
D08206, Methylephedrine hsa:154, (RefSeq) adrenoceptor beta 20.8371known
D01164, Aripiprazole hsa:1813, (RefSeq) dopamine receptor D20.8371known
D00407, Methylprednisolone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.837known
D06085, Testosterone ketolaurate hsa:367, (RefSeq) androgen receptor0.837known
D00601, Metoprolol tartrate hsa:153, (RefSeq) adrenoceptor beta 10.8369known
D07499, Benazepril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8369known
D07992, Fosinopril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8369known
D02149, Epinephrine bitartrate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8369known
D09796, Hydrocortisone caproate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8368new - training
D00690, Mometasone furoate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8366known
D01333, Urapidil hsa:147, (RefSeq) adrenoceptor alpha 1B0.8366known
D00976, Hydrocortisone cypionatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8366known
D00304, Divalproex sodium hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8366known
D02363, Ketanserin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8365known
D00524, Carbachol hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8365known
D05649, Pseudoephedrine sulfate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8364known
D01358, Mianserin hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8364known
D00756, Tetrahydrozoline nitrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8364known
D09794, Norepinephrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8363known
D00570, Colchicine hsa:10383, (RefSeq) tubulin beta 4B class IVb0.8363known
D00283, Clozapine hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8363known
D01505, Talipexole hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8362known
D07064, Acenocoumarol hsa:79001, (RefSeq) vitamin K epoxide reductase complex subunit 10.8362known
D00303, Disopyramide hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8362known
D04720, Levosimendan hsa:5139, (RefSeq) phosphodiesterase 3A0.8362known
D02910, Amiodarone hsa:148, (RefSeq) adrenoceptor alpha 1A0.8362known
D05008, Metoclopramide hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8362known
D00270, Chlorpromazine hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8361known
D04375, Guanabenz hsa:150, (RefSeq) adrenoceptor alpha 2A0.8361known
D01453, Caffeine hydrate hsa:134, (RefSeq) adenosine A1 receptor0.8361known
D01887, Bunazosin hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.836known
D00528, Caffeine hsa:134, (RefSeq) adenosine A1 receptor0.836known
D07717, Clobetasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.836known
D08001, Furosemide diolaminehsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.836known
D00999, Acetylcholine chloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8359known
D08149, Loxoprofen hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8359known
D08892, Clevidipine hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8358new - training
D00999, Acetylcholine chloride hsa:1137, (RefSeq) cholinergic receptor nicotinic alpha 4 subunit0.8358known
D00403, Methotrimeprazine hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8358known
D00304, Divalproex sodium hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8358known
D01382, Metharbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8358new - training
D01441, Imatinib mesylate hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.8357known
D01952, L-Methylephedrine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8356known
D02109, dl-Methylephedrine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8356known
D03274, Chlorpromazine hibenzate hsa:1813, (RefSeq) dopamine receptor D20.8356known
D02342, Bisoprolol hsa:153, (RefSeq) adrenoceptor beta 10.8356known
D01358, Mianserin hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8356known
D01386, Ephedrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8355known
D02149, Epinephrine bitartrate hsa:153, (RefSeq) adrenoceptor beta 10.8355known
D02321, Amsacrine hsa:7155, (RefSeq) DNA topoisomerase II beta0.8354known
D08685, Yohimbine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8354known
D02321, Amsacrine hsa:7153, (RefSeq) DNA topoisomerase II alpha0.8354known
D02247, Biperiden lactate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8354known
D07409, Pentetrazol hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8352known
D00827, Magnesium salicylate hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8352known
D08466, Ramosetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8351known
D07461, Apraclonidine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8351known
D01691, Nipradilol hsa:154, (RefSeq) adrenoceptor beta 20.8351known
D00509, Phentolamine mesylate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8351known
D05575, Pramipexole hsa:1814, (RefSeq) dopamine receptor D30.835known
D00715, Methscopolamine bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8349known
D08358, Phenoxybenzamine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8348known
D08947, Motesanib diphosphate hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8348known
D04703, Levalbuterol tartrate hsa:154, (RefSeq) adrenoceptor beta 20.8347known
D01479, Ambroxol hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8346known
D00537, Topiramate hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8346known
D01008, Apraclonidine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8346known
D00505, Phenelzine sulfate hsa:4129, (RefSeq) monoamine oxidase B0.8345known
D05008, Metoclopramide hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8345known
D00292, Dexamethasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8345known
D07540, Brimonidine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8345known
D01520, Levomepromazine hydrochloride hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8344known
D01471, Esatenolol hsa:153, (RefSeq) adrenoceptor beta 10.8344known
D00570, Colchicine hsa:10382, (RefSeq) tubulin beta 4A class IVa0.8343known
D03399, Carboprost methyl hsa:5737, (RefSeq) prostaglandin F receptor0.8343known
D02213, Metoclopramide hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8343known
D01382, Metharbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8342new - training
D01382, Metharbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8342new - training
D01163, Ergonovine maleate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8342known
D03180, Butabarbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8342new - training
D00599, Carteolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8342known
D00570, Colchicine hsa:347733, (RefSeq) tubulin beta 2B class IIb0.8341known
D00199, Ajmaline hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.834known
D03180, Butabarbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.834new - training
D01253, Clobazam hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.834known
D00825, Sertraline hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.834known
D08342, Perphenazine enantatehsa:1813, (RefSeq) dopamine receptor D20.834known
D00827, Magnesium salicylate hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.834known
D01382, Metharbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8339new - training
D03165, Bromocriptine hsa:1813, (RefSeq) dopamine receptor D20.8339known
D05339, Paliperidone hsa:1813, (RefSeq) dopamine receptor D20.8338known
D07099, Cimetropium bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8338known
D00570, Colchicine hsa:203068, (RefSeq) tubulin beta class I0.8338known
D02034, Setiptiline maleate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8338known
D01307, Midodrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8338known
D00199, Ajmaline hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8338known
D02163, Fluphenazine maleate hsa:1813, (RefSeq) dopamine receptor D20.8337known
D08366, Phenylephrine tartratehsa:147, (RefSeq) adrenoceptor alpha 1B0.8337known
D08966, Phenylephrine bitartrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8337known
D02825, Almotriptan malate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8337known
D01785, Pirmenol hydrochloride hydrate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8337known
D00680, Methylergonovine maleate hsa:152, (RefSeq) adrenoceptor alpha 2C0.8337known
D00978, Hydrocortisone sodium succinate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8336known
D03718, Dexibuprofen lysine hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8335known
D02969, Aprindine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8335known
D07906, Ergotamine hsa:1813, (RefSeq) dopamine receptor D20.8335known
D03180, Butabarbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8334new - training
D02275, Suxamethonium chloride hydrate hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.8334known
D08892, Clevidipine hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8334new - training
D08425, Procyclidine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8333known
D00303, Disopyramide hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8332known
D00605, Guanabenz acetate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8332known
D01382, Metharbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8331new - training
D01236, Conivaptan hydrochloride hsa:554, (RefSeq) arginine vasopressin receptor 20.833known
D08220, Midodrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.833known
D01382, Metharbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8329new - training
D00537, Topiramate hsa:2890, (RefSeq) glutamate ionotropic receptor AMPA type subunit 10.8329known
D04970, Methacholine chloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8328known
D00444, Stanozolol hsa:367, (RefSeq) androgen receptor0.8328known
D00622, Fosinopril sodium hsa:1636, (RefSeq) angiotensin I converting enzyme0.8327known
D00537, Topiramate hsa:2897, (RefSeq) glutamate ionotropic receptor kainate type subunit 10.8327known
D08624, Tramazoline hsa:147, (RefSeq) adrenoceptor alpha 1B0.8327known
D00685, Metaproterenol sulfate hsa:154, (RefSeq) adrenoceptor beta 20.8327known
D02213, Metoclopramide hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8326known
D09794, Norepinephrine hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8326known
D00759, Cisatracurium besylate hsa:1140, (RefSeq) cholinergic receptor nicotinic beta 1 subunit0.8326known
D00537, Topiramate hsa:2899, (RefSeq) glutamate ionotropic receptor kainate type subunit 30.8326known
D00511, Phenylephrine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8325known
D00302, Dipyridamole hsa:5140, (RefSeq) phosphodiesterase 3B0.8325known
D02286, Betamethasone benzoate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8325known
D08284, Norepinephrine hydrochoridehsa:152, (RefSeq) adrenoceptor alpha 2C0.8325known
D00680, Methylergonovine maleate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8325known
D04257, Fospropofol disodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8324known
D00570, Colchicine hsa:7280, (RefSeq) tubulin beta 2A class IIa0.8323known
D09794, Norepinephrine hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8323known
D05024, Mibefradil dihydrochloride hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8323known
D07624, Carteolol hsa:155, (RefSeq) adrenoceptor beta 30.8323known
D07905, Ergometrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8322known
D02537, Dronedarone hsa:153, (RefSeq) adrenoceptor beta 10.8322known
D01163, Ergonovine maleate hsa:3354, (RefSeq) 5-hydroxytryptamine receptor 1E0.8321known
D05024, Mibefradil dihydrochloride hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8321known
D04034, Chlorpromazine phenolphthalinate hsa:3269, (RefSeq) histamine receptor H10.8321known
D01382, Metharbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8321new - training
D00076, Noradrenaline hsa:153, (RefSeq) adrenoceptor beta 10.832known
D06396, Renzapride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.832known
D00303, Disopyramide hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8319known
D00996, Epinephrine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8319known
D00524, Carbachol hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8318known
D02616, Pagoclone hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8317known
D00451, Sumatriptan hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8317known
D00603, Timolol maleate hsa:153, (RefSeq) adrenoceptor beta 10.8317known
D08206, Methylephedrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8317known
D08511, Setiptiline hsa:147, (RefSeq) adrenoceptor alpha 1B0.8316known
D02105, Tetracosactide acetate hsa:4157, (RefSeq) melanocortin 1 receptor0.8315known
D00699, Butabarbital sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8314new - training
D06272, Sorafenib tosylate hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8314known
D08892, Clevidipine hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8314new - training
D00623, Moexipril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8314known
D04214, Flunisolide acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8312known
D00088, Hydrocortisone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8312known
D01201, Tiemonium iodide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8311known
D00636, Amiodarone hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8311known
D00712, Methohexital sodium hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.831new - training
D08362, Phentolamine hsa:148, (RefSeq) adrenoceptor alpha 1A0.831known
D01691, Nipradilol hsa:155, (RefSeq) adrenoceptor beta 30.831known
D00996, Epinephrine hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8309known
D09794, Norepinephrine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8309known
D03854, Diphenhydramine citrate hsa:3269, (RefSeq) histamine receptor H10.8309known
D00537, Topiramate hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8308known
D00252, Carbamazepine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8308known
D01952, L-Methylephedrine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8307known
D02109, dl-Methylephedrine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8307known
D00962, Clomiphene citrate hsa:2099, (RefSeq) estrogen receptor 10.8307known
D01165, Piperidolate hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8307known
D07867, Dolasetron hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8306known
D01382, Metharbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8306new - training
D08086, Irinotecan hsa:7150, (RefSeq) DNA topoisomerase I0.8306known
D08492, Rosuvastatin hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8305known
D00463, Oxaprozin hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8305known
D03218, Axitinib hsa:3791, (RefSeq) kinase insert domain receptor0.8305known
D08116, Levobupivacaine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8305new - training
D02910, Amiodarone hsa:146, (RefSeq) adrenoceptor alpha 1D0.8304known
D07827, Diflorasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8304known
D03914, Dronedarone hydrochloride hsa:3767, (RefSeq) potassium inwardly rectifying channel subfamily J member 110.8304known
D08207, Methylergometrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8303known
D01599, Gliclazide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.8303known
D00715, Methscopolamine bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8303known
D00725, Dolasetron mesylate hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8303known
D01825, Fluocinolone acetonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8301known
D00712, Methohexital sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.83new - training
D00120, Sulindac hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.83known
D01445, Ifenprodil tartrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.83known
D00603, Timolol maleate hsa:155, (RefSeq) adrenoceptor beta 30.83known
D07624, Carteolol hsa:154, (RefSeq) adrenoceptor beta 20.83known
D01000, Bethanechol chloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8299known
D00962, Clomiphene citrate hsa:2100, (RefSeq) estrogen receptor 20.8299known
D00570, Colchicine hsa:84617, (RefSeq) tubulin beta 6 class V0.8298known
D00403, Methotrimeprazine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8298known
D01367, Fluorometholone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8298known
D00787, Trihexyphenidyl hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8297known
D08181, Mepivacaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8297new - training
D01103, Trospium chloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8297known
D08132, Lisuride hsa:1813, (RefSeq) dopamine receptor D20.8297known
D07520, Bepridil hsa:3767, (RefSeq) potassium inwardly rectifying channel subfamily J member 110.8296known
D00552, Benzocaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8296known
D01002, Cyclopentolate hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8296known
D07449, Amitriptylinoxide hsa:6532, (RefSeq) solute carrier family 6 member 40.8296known
D00537, Topiramate hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8296known
D09794, Norepinephrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8296known
D02105, Tetracosactide acetate hsa:4158, (RefSeq) melanocortin 2 receptor0.8295known
D02983, Argipressin tannate hsa:552, (RefSeq) arginine vasopressin receptor 1A0.8295known
D07905, Ergometrine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8294known
D01025, Levobunolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8293known
D03740, Dextroamphetamine hsa:6532, (RefSeq) solute carrier family 6 member 40.8293known
D00766, Succinylcholine chloride hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.8293known
D02016, Ramosetron hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8293known
D03671, Deflazacort hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8293known
D08092, Isoxsuprine hsa:154, (RefSeq) adrenoceptor beta 20.8292known
D01402, Betamethasone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8291known
D00458, Quetiapine fumarate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8291known
D07129, Alosetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8291known
D00679, Ergotamine tartrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.829known
D02616, Pagoclone hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.829known
D00725, Dolasetron mesylate hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.829known
D08636, Trifluoperazine hsa:1813, (RefSeq) dopamine receptor D20.8289known
D00972, Betamethasone sodium phosphate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8289known
D00751, Methylprednisolone sodium succinate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8288known
D02078, Dextroamphetamine sulfate hsa:6532, (RefSeq) solute carrier family 6 member 40.8287known
D00573, Goserelin acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8287known
D01634, Piretanide hsa:6558, (RefSeq) solute carrier family 12 member 20.8283known
D03713, Dexfenfluramine hydrochloride hsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.8283known
D08662, Urapidil hydrochloridehsa:146, (RefSeq) adrenoceptor alpha 1D0.8282known
D00712, Methohexital sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8282new - training
D00513, Pindolol hsa:154, (RefSeq) adrenoceptor beta 20.8281known
D06678, Motesanib hsa:3815, (RefSeq) KIT proto-oncogene0.8281known
D01830, Arotinolol hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8281known
D00199, Ajmaline hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8281known
D06645, Sitagliptin phosphate hsa:1803, (RefSeq) dipeptidyl peptidase 40.828known
D00477, Procainamide hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.828known
D02016, Ramosetron hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.828known
D00538, Zonisamide hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8279known
D08555, Tacrine hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.8279known
D07129, Alosetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8279known
D08435, Propafenone hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8278known
D02149, Epinephrine bitartrate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8278known
D00564, Warfarin sodium hsa:1728, (RefSeq) NAD(P)H quinone dehydrogenase 10.8278known
D00303, Disopyramide hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8277known
D01448, Trifluoperazine maleate hsa:1813, (RefSeq) dopamine receptor D20.8277known
D08216, Mianserin hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.8277known
D02151, Tulobuterol hsa:154, (RefSeq) adrenoceptor beta 20.8277known
D00373, Thioridazine hsa:1813, (RefSeq) dopamine receptor D20.8277known
D01464, Flumethasone pivalate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8277known
D00679, Ergotamine tartrate hsa:1813, (RefSeq) dopamine receptor D20.8276known
D08619, Torasemide sodiumhsa:6557, (RefSeq) solute carrier family 12 member 10.8275known
D00603, Timolol maleate hsa:154, (RefSeq) adrenoceptor beta 20.8275known
D07661, Cerivastatin hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.8275known
D02116, Histrelin acetatehsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8274known
D02616, Pagoclone hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8274known
D04531, Indoramin hsa:147, (RefSeq) adrenoceptor alpha 1B0.8274known
D00636, Amiodarone hydrochloride hsa:3752, (RefSeq) potassium voltage-gated channel subfamily D member 30.8273known
D08611, Tizanidine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8273known
D02729, Itopride hydrochloride hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.8273known
D07905, Ergometrine hsa:1813, (RefSeq) dopamine receptor D20.8273known
D02616, Pagoclone hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8273known
D02616, Pagoclone hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8273known
D00552, Benzocaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8272known
D08149, Loxoprofen hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8272known
D01362, Tulobuterol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8271known
D02829, Alosetron hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8271known
D02034, Setiptiline maleate hsa:150, (RefSeq) adrenoceptor alpha 2A0.827known
D08284, Norepinephrine hydrochoridehsa:154, (RefSeq) adrenoceptor beta 20.827known
D00732, Chloroprocaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8269known
D00540, Glycopyrrolate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8269known
D00823, Fluoxetine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8268known
D01253, Clobazam hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8268known
D05206, Norepinephrine bitartrate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8268known
D02616, Pagoclone hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8267known
D00537, Topiramate hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8267known
D02609, Prochlorperazine edisylate hsa:1813, (RefSeq) dopamine receptor D20.8266known
D00537, Topiramate hsa:2901, (RefSeq) glutamate ionotropic receptor kainate type subunit 50.8266known
D00509, Phentolamine mesylate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8265known
D01491, Butropium bromide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8264known
D08106, Labetalol hsa:153, (RefSeq) adrenoceptor beta 10.8263known
D08362, Phentolamine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8262known
D00605, Guanabenz acetate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8262known
D02130, Tropisetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8262known
D03360, Diphenhydramine laurylsulfate hsa:3269, (RefSeq) histamine receptor H10.8262known
D00732, Chloroprocaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8262known
D02369, Histrelin hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8261known
D01022, Oxymetazoline hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8261known
D02616, Pagoclone hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8261known
D01382, Metharbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8261new - training
D08362, Phentolamine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8261known
D08094, Itopride hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.826known
D00304, Divalproex sodium hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8259known
D02829, Alosetron hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8259known
D03274, Chlorpromazine hibenzate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8259known
D08207, Methylergometrine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8258known
D00354, Lamotrigine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8258known
D05649, Pseudoephedrine sulfate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8258known
D00699, Butabarbital sodium hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8258new - training
D08449, Pseudoephedrine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8258known
D08639, Trimebutine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8258known
D07445, Amfetamine hsa:6532, (RefSeq) solute carrier family 6 member 40.8258known
D08511, Setiptiline hsa:151, (RefSeq) adrenoceptor alpha 2B0.8256known
D02616, Pagoclone hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8256known
D08892, Clevidipine hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8256new - training
D07977, Fluphenazine hsa:1813, (RefSeq) dopamine receptor D20.8256known
D00076, Noradrenaline hsa:152, (RefSeq) adrenoceptor alpha 2C0.8255known
D01358, Mianserin hydrochloride hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8254known
D01386, Ephedrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8254known
D01500, Trimebutine maleate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8254known
D08687, Ziprasidone hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8252known
D00432, Nadolol hsa:154, (RefSeq) adrenoceptor beta 20.8252known
D00537, Topiramate hsa:2900, (RefSeq) glutamate ionotropic receptor kainate type subunit 40.8252known
D02130, Tropisetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8251known
D01253, Clobazam hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8251known
D08070, Imipramine hsa:6530, (RefSeq) solute carrier family 6 member 20.825known
D08692, Zuclopenthixol decanoatehsa:1813, (RefSeq) dopamine receptor D20.825known
D07442, Ambroxol hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8249known
D01653, Benserazide hydrochloride hsa:1644, (RefSeq) dopa decarboxylase0.8249known
D00999, Acetylcholine chloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8249known
D00798, Thioridazine hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8249known
D08227, Mometasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8248known
D08241, Nafarelin hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8248known
D00570, Colchicine hsa:347688, (RefSeq) tubulin beta 8 class VIII0.8248known
D00604, Clonidine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8247known
D02034, Setiptiline maleate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8247known
D03325, Mometasone furoate hydrate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8247known
D01023, Tetrahydrozoline hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8247known
D01504, Bufetolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8246known
D07550, Bunazosin hsa:146, (RefSeq) adrenoceptor alpha 1D0.8246known
D00598, Betaxolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8246known
D01390, Isoproterenol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8245known
D08066, Imatinib hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.8245known
D00715, Methscopolamine bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8245known
D00699, Butabarbital sodium hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8245new - training
D02108, Indium In 111 pentetreotide hsa:6753, (RefSeq) somatostatin receptor 30.8244known
D07748, Conivaptan hsa:554, (RefSeq) arginine vasopressin receptor 20.8244known
D00511, Phenylephrine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8243known
D02275, Suxamethonium chloride hydrate hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.8243known
D08416, Prednisone acetatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8243known
D07906, Ergotamine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8243known
D00483, Propranolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8242known
D02357, Methysergide hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8242known
D01462, Lisuride maleate hsa:1813, (RefSeq) dopamine receptor D20.8242known
D00776, Tizanidine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8241known
D00640, Propafenone hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8241known
D07511, Benzatropine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8241known
D00990, Nafarelin acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8241known
D00509, Phentolamine mesylate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8241known
D07511, Benzatropine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8241known
D01482, Pipamperone hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.824known
D04226, Flupirtine maleate hsa:2903, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2A0.824known
D04257, Fospropofol disodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.824known
D00498, Pentazocine hsa:4986, (RefSeq) opioid receptor kappa 10.824known
D08206, Methylephedrine hsa:152, (RefSeq) adrenoceptor alpha 2C0.824known
D05523, Pizotyline hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8239known
D02235, Desmopressin acetate hsa:553, (RefSeq) arginine vasopressin receptor 1B0.8238known
D02616, Pagoclone hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.8238known
D07543, Brompheniramine hsa:3269, (RefSeq) histamine receptor H10.8237known
D02213, Metoclopramide hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8237known
D00656, Methyclothiazide hsa:6559, (RefSeq) solute carrier family 12 member 30.8237known
D01382, Metharbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8237new - training
D00519, Chlorothiazide hsa:6559, (RefSeq) solute carrier family 12 member 30.8236known
D01692, Alfuzosin hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8235known
D08217, Mibefradil hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8234known
D01107, Milnacipran hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8233known
D01445, Ifenprodil tartrate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8233known
D08217, Mibefradil hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8231known
D08570, Terbutaline hsa:154, (RefSeq) adrenoceptor beta 20.8231known
D01358, Mianserin hydrochloride hsa:3354, (RefSeq) 5-hydroxytryptamine receptor 1E0.8231known
D00681, Methysergide maleate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8231known
D08578, Tetryzoline hsa:148, (RefSeq) adrenoceptor alpha 1A0.8231known
D06413, Nilotinib hydrochloride hydrate hsa:5156, (RefSeq) platelet derived growth factor receptor alpha0.8231known
D00680, Methylergonovine maleate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8229known
D02098, Proparacaine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8229known
D02211, Dihydroergotamine mesylate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8229known
D00537, Topiramate hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.8227known
D02041, Tropisetron hydrochloride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8226known
D07862, Diphenylpyraline hsa:3269, (RefSeq) histamine receptor H10.8226known
D01811, Salicylamide hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8225known
D00270, Chlorpromazine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8225known
D07124, Alfuzosin hsa:146, (RefSeq) adrenoceptor alpha 1D0.8224known
D00712, Methohexital sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8224new - training
D02108, Indium In 111 pentetreotide hsa:6754, (RefSeq) somatostatin receptor 40.8224known
D00537, Topiramate hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8222known
D07905, Ergometrine hsa:3354, (RefSeq) 5-hydroxytryptamine receptor 1E0.8222known
D01604, Efonidipine hydrochloride ethanolate hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8221known
D08511, Setiptiline hsa:148, (RefSeq) adrenoceptor alpha 1A0.822known
D01246, Benzylhydrochlorothiazide hsa:6559, (RefSeq) solute carrier family 12 member 30.822known
D00778, Benztropine mesylate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8218known
D01600, Diphenylpiperidinomethyldioxolan iodide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8218known
D07971, Flunarizine hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8216known
D00509, Phentolamine mesylate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8216known
D03274, Chlorpromazine hibenzate hsa:152, (RefSeq) adrenoceptor alpha 2C0.8216known
D07874, Doxazosin hsa:146, (RefSeq) adrenoceptor alpha 1D0.8215known
D01387, Amcinonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8214known
D00815, Imipramine hydrochloride hsa:6530, (RefSeq) solute carrier family 6 member 20.8214known
D00291, Desmopressin hsa:553, (RefSeq) arginine vasopressin receptor 1B0.8214known
D02041, Tropisetron hydrochloride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8214known
D00124, Ephedrine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8214known
D00538, Zonisamide hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8214known
D00997, Tolazoline hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8214known
D07971, Flunarizine hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.8214known
D02537, Dronedarone hsa:3767, (RefSeq) potassium inwardly rectifying channel subfamily J member 110.8213known
D01748, Isoxsuprine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8212known
D08318, Oxprenolol hsa:155, (RefSeq) adrenoceptor beta 30.8212known
D01830, Arotinolol hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8211known
D01163, Ergonovine maleate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8211known
D02098, Proparacaine hydrochloride hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8211known
D01741, Celiprolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8211known
D04208, Flumethasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8211known
D00524, Carbachol hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8209known
D04218, Fluocortolone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8209known
D00473, Prednisone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8208known
D00782, Procyclidine hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8208known
D01101, Bromperidol hsa:1813, (RefSeq) dopamine receptor D20.8208known
D08207, Methylergometrine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8208known
D01491, Butropium bromide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8207known
D00643, Quinidine polygalacturonatehsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8206known
D08611, Tizanidine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8206known
D08215, Mexiletine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8204known
D00559, Pramipexole dihydrochloride hsa:1814, (RefSeq) dopamine receptor D30.8202known
D08485, Rizatriptan hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.82known
D08358, Phenoxybenzamine hsa:151, (RefSeq) adrenoceptor alpha 2B0.82known
D00812, Desipramine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8199known
D00321, Finasteride hsa:6716, (RefSeq) steroid 5 alpha-reductase 20.8199known
D00631, Bepridil hydrochloride hsa:3767, (RefSeq) potassium inwardly rectifying channel subfamily J member 110.8199known
D00458, Quetiapine fumarate hsa:3269, (RefSeq) histamine receptor H10.8199known
D01340, Naloxone hydrochloride hsa:4986, (RefSeq) opioid receptor kappa 10.8198known
D02236, Flupentixol dihydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8198known
D00636, Amiodarone hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8198known
D02616, Pagoclone hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.8197known
D00403, Methotrimeprazine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8196known
D01253, Clobazam hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8196known
D00811, Clomipramine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8194known
D01911, Aclarubicin hydrochloride hsa:7150, (RefSeq) DNA topoisomerase I0.8194known
D07511, Benzatropine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8193known
D07837, Dihydroergotamine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8192known
D00538, Zonisamide hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8192known
D03767, Zofenopril calcium hsa:1636, (RefSeq) angiotensin I converting enzyme0.819known
D08318, Oxprenolol hsa:154, (RefSeq) adrenoceptor beta 20.819known
D00321, Finasteride hsa:6715, (RefSeq) steroid 5 alpha-reductase 10.8189known
D08181, Mepivacaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8189new - training
D08639, Trimebutine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8189known
D00699, Butabarbital sodium hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8189new - training
D08255, Naratriptan hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8188known
D08106, Labetalol hsa:155, (RefSeq) adrenoceptor beta 30.8188known
D03180, Butabarbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8188new - training
D07973, Fluocortolone 21-pivalatehsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8187known
D08049, Hydroquinidine hydrochloridehsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8186new - training
D04034, Chlorpromazine phenolphthalinate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8186known
D00778, Benztropine mesylate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8184known
D01672, Gabexate mesilate hsa:3817, (RefSeq) kallikrein related peptidase 20.8184known
D00996, Epinephrine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8184known
D01304, Amezinium metilsulfate hsa:4128, (RefSeq) monoamine oxidase A0.8183known
D05206, Norepinephrine bitartrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8183known
D00304, Divalproex sodium hsa:253175, (RefSeq) chromodomain Y-linked 1B0.8183known
D00608, Doxazosin mesylate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8182known
D02616, Pagoclone hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.8182known
D01491, Butropium bromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8181known
D01382, Metharbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.818new - training
D07978, Flupirtine hsa:2903, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2A0.818new - training
D03914, Dronedarone hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.818known
D04226, Flupirtine maleate hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.818known
D01500, Trimebutine maleate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8179known
D00304, Divalproex sodium hsa:203611, (RefSeq) chromodomain Y-linked 2B0.8179known
D00304, Divalproex sodium hsa:9426, (RefSeq) chromodomain Y-linked 2A0.8179known
D01811, Salicylamide hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8178known
D08004, Gabexate hsa:3817, (RefSeq) kallikrein related peptidase 20.8178known
D04116, Eucatropine hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8178known
D04018, Ephedrine sulfate hsa:155, (RefSeq) adrenoceptor beta 30.8177known
D00604, Clonidine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8177known
D05011, Metoprolol fumarate hsa:153, (RefSeq) adrenoceptor beta 10.8176known
D00989, Leuprolide acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8175known
D03180, Butabarbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8175new - training
D00539, Ethosuximide hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.8175known
D00643, Quinidine polygalacturonatehsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.8175known
D00787, Trihexyphenidyl hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8174known
D02211, Dihydroergotamine mesylate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8174known
D00537, Topiramate hsa:2892, (RefSeq) glutamate ionotropic receptor AMPA type subunit 30.8174known
D01573, Etilefrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8172known
D06315, Fluticasone furoate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8172known
D00665, Chlorpheniramine maleate hsa:3269, (RefSeq) histamine receptor H10.8171known
D00367, Mazindol hsa:6532, (RefSeq) solute carrier family 6 member 40.8171known
D01820, Alclometasone dipropionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.817known
D00513, Pindolol hsa:155, (RefSeq) adrenoceptor beta 30.817known
D07983, Fluvastatin hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.817known
D01703, Ciclesonide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.817known
D00563, Mirtazapine hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.817known
D02824, Almotriptan hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.817known
D03914, Dronedarone hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.817known
D04221, Fluorometholone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8168known
D06566, Bifeprunox hsa:1813, (RefSeq) dopamine receptor D20.8167new - training
D08449, Pseudoephedrine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8167known
D07099, Cimetropium bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8165known
D02078, Dextroamphetamine sulfate hsa:6530, (RefSeq) solute carrier family 6 member 20.8165known
D00643, Quinidine polygalacturonatehsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.8165known
D00643, Quinidine polygalacturonatehsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8164known
D08619, Torasemide sodiumhsa:6558, (RefSeq) solute carrier family 12 member 20.8161known
D02235, Desmopressin acetate hsa:552, (RefSeq) arginine vasopressin receptor 1A0.8161known
D02108, Indium In 111 pentetreotide hsa:6755, (RefSeq) somatostatin receptor 50.8161known
D00600, Labetalol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8161known
D00101, Vasopressin hsa:554, (RefSeq) arginine vasopressin receptor 20.816known
D08638, Trihexyphenidyl hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8159known
D00313, Ethacrynic acid hsa:6557, (RefSeq) solute carrier family 12 member 10.8157known
D00686, Pirbuterol acetate hsa:154, (RefSeq) adrenoceptor beta 20.8157known
D05649, Pseudoephedrine sulfate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8157known
D08300, Orciprenaline hsa:154, (RefSeq) adrenoceptor beta 20.8156known
D02108, Indium In 111 pentetreotide hsa:6752, (RefSeq) somatostatin receptor 20.8155known
D00076, Noradrenaline hsa:155, (RefSeq) adrenoceptor beta 30.8155known
D01546, Dothiepin hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8154known
D06672, Terlipressin hsa:554, (RefSeq) arginine vasopressin receptor 20.8153known
D02371, Clocapramine hydrochloride hydrate hsa:1813, (RefSeq) dopamine receptor D20.8152known
D07465, Arotinolol hsa:154, (RefSeq) adrenoceptor beta 20.8152known
D01111, Nateglinide hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.8152known
D00552, Benzocaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8151known
D08362, Phentolamine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8151known
D00426, Risperidone hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8151known
D09794, Norepinephrine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8151known
D07406, Pimethixene hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.815known
D07617, Carbinoxamine hsa:3269, (RefSeq) histamine receptor H10.8149known
D00252, Carbamazepine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8149known
D08040, Histamine hsa:3274, (RefSeq) histamine receptor H20.8149known
D02359, Ritodrine hsa:154, (RefSeq) adrenoceptor beta 20.8149known
D08064, Ifenprodil hsa:146, (RefSeq) adrenoceptor alpha 1D0.8147known
D08435, Propafenone hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8146known
D02081, Metipranolol hydrochloridehsa:153, (RefSeq) adrenoceptor beta 10.8146known
D01019, Metaraminol bitartrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8145known
D02374, Metipranolol hsa:155, (RefSeq) adrenoceptor beta 30.8145known
D01491, Butropium bromide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8144known
D01021, Naphazoline nitrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8144known
D00432, Nadolol hsa:155, (RefSeq) adrenoceptor beta 30.8144known
D08578, Tetryzoline hsa:147, (RefSeq) adrenoceptor alpha 1B0.8144known
D01373, Formoterol fumarate hsa:154, (RefSeq) adrenoceptor beta 20.8144known
D00712, Methohexital sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8142new - training
D00199, Ajmaline hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8142known
D02995, Asenapine maleate hsa:148, (RefSeq) adrenoceptor alpha 1A0.814known
D01347, Tramazoline hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8139known
D04226, Flupirtine maleate hsa:2905, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2C0.8139known
D00826, Tranylcypromine sulfate hsa:4128, (RefSeq) monoamine oxidase A0.8139known
D00766, Succinylcholine chloride hsa:1140, (RefSeq) cholinergic receptor nicotinic beta 1 subunit0.8139known
D00340, Hydrochlorothiazide hsa:6559, (RefSeq) solute carrier family 12 member 30.8139known
D07406, Pimethixene hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8139known
D00271, Chlorpropamide hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.8138known
D02910, Amiodarone hsa:3762, (RefSeq) potassium inwardly rectifying channel subfamily J member 50.8138known
D01500, Trimebutine maleate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8137known
D05277, Formoterol fumarate hydrate hsa:154, (RefSeq) adrenoceptor beta 20.8136known
D05340, Paliperidone palmitate hsa:1813, (RefSeq) dopamine receptor D20.8136known
D00291, Desmopressin hsa:552, (RefSeq) arginine vasopressin receptor 1A0.8136known
D07837, Dihydroergotamine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8136known
D00303, Disopyramide hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8135known
D08424, Procaterol hsa:154, (RefSeq) adrenoceptor beta 20.8135known
D06396, Renzapride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.8135known
D04018, Ephedrine sulfate hsa:147, (RefSeq) adrenoceptor alpha 1B0.8135known
D08106, Labetalol hsa:154, (RefSeq) adrenoceptor beta 20.8134known
D01333, Urapidil hsa:146, (RefSeq) adrenoceptor alpha 1D0.8134known
D00387, Triazolam hsa:2741, (RefSeq) glycine receptor alpha 10.8133training - new
D00741, Tetracaine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8133known
D01672, Gabexate mesilate hsa:3816, (RefSeq) kallikrein 10.8133known
D00689, Beclomethasone dipropionate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8132known
D04316, Gestodene hsa:5241, (RefSeq) progesterone receptor0.8132known
D00600, Labetalol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8131known
D02372, Perospirone hydrochloride hydrate hsa:1813, (RefSeq) dopamine receptor D20.813known
D02613, Clopenthixol hsa:1813, (RefSeq) dopamine receptor D20.813known
D07713, Clenbuterol hsa:154, (RefSeq) adrenoceptor beta 20.8129known
D07563, Alizapride hydrochloridehsa:1813, (RefSeq) dopamine receptor D20.8129known
D00636, Amiodarone hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8129known
D08466, Ramosetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8129known
D08511, Setiptiline hsa:150, (RefSeq) adrenoceptor alpha 2A0.8128known
D08207, Methylergometrine hsa:1813, (RefSeq) dopamine receptor D20.8128known
D00676, Sumatriptan succinate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8128known
D04405, Goserelin hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8127known
D08004, Gabexate hsa:3816, (RefSeq) kallikrein 10.8127known
D02995, Asenapine maleate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8126known
D00304, Divalproex sodium hsa:9085, (RefSeq) chromodomain Y-linked 10.8126known
D05380, Pazopanib hydrochloride hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.8124known
D00507, Phenoxybenzamine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.8124known
D01692, Alfuzosin hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8123known
D07214, Tiratricol hsa:7067, (RefSeq) thyroid hormone receptor alpha0.8123known
D01103, Trospium chloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8123known
D00984, Triamcinolone diacetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8123known
D01408, Flurazepam hydrochloride hsa:2741, (RefSeq) glycine receptor alpha 10.8122training - new
D03180, Butabarbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8121new - training
D02076, Brimonidine tartrate hsa:152, (RefSeq) adrenoceptor alpha 2C0.8121known
D01382, Metharbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.812new - training
D08466, Ramosetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8119known
D07511, Benzatropine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8119known
D00640, Propafenone hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8118known
D04532, Indoramin hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8118known
D07878, Doxylamine hsa:3269, (RefSeq) histamine receptor H10.8118known
D03415, Carvedilol phosphate hsa:153, (RefSeq) adrenoceptor beta 10.8118known
D07978, Flupirtine hsa:2905, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2C0.8117new - training
D00732, Chloroprocaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8117known
D02149, Epinephrine bitartrate hsa:155, (RefSeq) adrenoceptor beta 30.8117known
D08572, Tertatolol hydrochloridehsa:153, (RefSeq) adrenoceptor beta 10.8117known
D08031, Guanfacine hsa:151, (RefSeq) adrenoceptor alpha 2B0.8116known
D00848, Dextromethorphan hydrobromide hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.8116known
D00302, Dipyridamole hsa:8654, (RefSeq) phosphodiesterase 5A0.8116known
D00251, Captopril hsa:1636, (RefSeq) angiotensin I converting enzyme0.8116known
D02616, Pagoclone hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.8116known
D08207, Methylergometrine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8115known
D05649, Pseudoephedrine sulfate hsa:151, (RefSeq) adrenoceptor alpha 2B0.8115known
D00778, Benztropine mesylate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8115known
D08491, Rosiglitazone hsa:5468, (RefSeq) peroxisome proliferator activated receptor gamma0.8114known
D01253, Clobazam hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8114known
D04116, Eucatropine hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8114known
D07227, Ornipressin hsa:554, (RefSeq) arginine vasopressin receptor 20.8114known
D04034, Chlorpromazine phenolphthalinate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8114known
D00503, Perphenazine hsa:1813, (RefSeq) dopamine receptor D20.8113known
D01830, Arotinolol hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8113known
D03621, Cyclizine hsa:3269, (RefSeq) histamine receptor H10.8112known
D02825, Almotriptan malate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8112known
D00281, Clonidine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8111known
D02034, Setiptiline maleate hsa:152, (RefSeq) adrenoceptor alpha 2C0.8111known
D08571, Terlipressin acetate hsa:553, (RefSeq) arginine vasopressin receptor 1B0.8111known
D00403, Methotrimeprazine hsa:152, (RefSeq) adrenoceptor alpha 2C0.811known
D05429, Aminophylline hydrate hsa:135, (RefSeq) adenosine A2a receptor0.811known
D08625, Tranylcypromine hsa:4128, (RefSeq) monoamine oxidase A0.8109known
D07526, Betaxolol hsa:153, (RefSeq) adrenoceptor beta 10.8109known
D02066, Isoproterenol sulfate hsa:153, (RefSeq) adrenoceptor beta 10.8109known
D00996, Epinephrine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8108known
D00354, Lamotrigine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8108known
D00809, Amitriptyline hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8108known
D00403, Methotrimeprazine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8108known
D00763, Mivacurium chloride hsa:1134, (RefSeq) cholinergic receptor nicotinic alpha 1 subunit0.8107known
D08366, Phenylephrine tartratehsa:146, (RefSeq) adrenoceptor alpha 1D0.8107known
D08966, Phenylephrine bitartrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8107known
D08216, Mianserin hsa:3357, (RefSeq) 5-hydroxytryptamine receptor 2B0.8107known
D03290, Promethazine methylenedisalicylate hsa:3269, (RefSeq) histamine receptor H10.8106known
D02008, Tadalafil hsa:8654, (RefSeq) phosphodiesterase 5A0.8105known
D02580, Isocarboxazid hsa:4128, (RefSeq) monoamine oxidase A0.8104known
D03765, Spirapril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8104known
D02034, Setiptiline maleate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8103known
D01323, Azosemide hsa:6557, (RefSeq) solute carrier family 12 member 10.8103known
D01382, Metharbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8103new - training
D00699, Butabarbital sodium hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8103new - training
D07978, Flupirtine hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.8102new - training
D07214, Tiratricol hsa:7068, (RefSeq) thyroid hormone receptor beta0.8101known
D03740, Dextroamphetamine hsa:6530, (RefSeq) solute carrier family 6 member 20.81known
D07406, Pimethixene hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8098known
D00820, Trazodone hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.8096known
D00658, Trichlormethiazide hsa:6559, (RefSeq) solute carrier family 12 member 30.8096known
D08638, Trihexyphenidyl hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8096known
D08660, Ulobetasol hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8095known
D02093, Isoetharine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8095known
D00483, Propranolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8095known
D08624, Tramazoline hsa:146, (RefSeq) adrenoceptor alpha 1D0.8094known
D07890, Emedastine hsa:3269, (RefSeq) histamine receptor H10.8094known
D02995, Asenapine maleate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8093known
D02150, l-Isoprenaline hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8093known
D02535, Timepidium bromide hydrate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8093known
D04997, Methyldopate hydrochloride hsa:1644, (RefSeq) dopa decarboxylase0.8092new - training
D00293, Diazepam hsa:2741, (RefSeq) glycine receptor alpha 10.8091training - new
D08358, Phenoxybenzamine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8091known
D08093, Isoxsuprine lactatehsa:154, (RefSeq) adrenoceptor beta 20.8091known
D00367, Mazindol hsa:6530, (RefSeq) solute carrier family 6 member 20.8091known
D00387, Triazolam hsa:8001, (RefSeq) glycine receptor alpha 30.8091training - new
D00715, Methscopolamine bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.809known
D01745, Domperidone hsa:1813, (RefSeq) dopamine receptor D20.809known
D08288, Nortriptyline hsa:6532, (RefSeq) solute carrier family 6 member 40.8088known
D08091, Isothipendyl hsa:3269, (RefSeq) histamine receptor H10.8088known
D00680, Methylergonovine maleate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8088known
D00999, Acetylcholine chloride hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.8087known
D00733, Dibucaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.8087known
D03106, Bexarotene hsa:6256, (RefSeq) retinoid X receptor alpha0.8087known
D07867, Dolasetron hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.8087known
D02275, Suxamethonium chloride hydrate hsa:1140, (RefSeq) cholinergic receptor nicotinic beta 1 subunit0.8087known
D04116, Eucatropine hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8087known
D00778, Benztropine mesylate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8087known
D06567, Bifeprunox mesylate hsa:1813, (RefSeq) dopamine receptor D20.8085known
D02622, Pipamperone hsa:1813, (RefSeq) dopamine receptor D20.8085known
D08358, Phenoxybenzamine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8085known
D00999, Acetylcholine chloride hsa:1134, (RefSeq) cholinergic receptor nicotinic alpha 1 subunit0.8085known
D02102, Methadone hydrochloride hsa:2905, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2C0.8085known
D00787, Trihexyphenidyl hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8084known
D08207, Methylergometrine hsa:3354, (RefSeq) 5-hydroxytryptamine receptor 1E0.8084known
D04375, Guanabenz hsa:152, (RefSeq) adrenoceptor alpha 2C0.8083known
D00124, Ephedrine hsa:153, (RefSeq) adrenoceptor beta 10.8081known
D07868, Domperidone maleatehsa:1813, (RefSeq) dopamine receptor D20.8081known
D00733, Dibucaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.8081known
D08147, Loteprednol hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8081known
D00600, Labetalol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.808known
D07102, Alizapride hsa:1813, (RefSeq) dopamine receptor D20.808known
D05010, Metopimazine hsa:1813, (RefSeq) dopamine receptor D20.808known
D00774, Orphenadrine citrate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.808known
D01500, Trimebutine maleate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8079known
D01408, Flurazepam hydrochloride hsa:8001, (RefSeq) glycine receptor alpha 30.8079training - new
D03182, Butalbital hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8079new - training
D03954, Edotecarin hsa:7150, (RefSeq) DNA topoisomerase I0.8079known
D08594, Ticlopidine hsa:64805, (RefSeq) purinergic receptor P2Y120.8079known
D00796, Molindone hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8078known
D08387, Pirbuterol hsa:154, (RefSeq) adrenoceptor beta 20.8077known
D03756, Indolapril hydrochloride hsa:1636, (RefSeq) angiotensin I converting enzyme0.8076known
D03225, Belotecan hydrochloride hsa:7150, (RefSeq) DNA topoisomerase I0.8076known
D08124, Levosalbutamol hsa:154, (RefSeq) adrenoceptor beta 20.8075known
D07867, Dolasetron hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.8074known
D08685, Yohimbine hsa:152, (RefSeq) adrenoceptor alpha 2C0.8073known
D03822, Rivastigmine hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.8072known
D01002, Cyclopentolate hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8072known
D01008, Apraclonidine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.8071known
D00824, Fluvoxamine maleate hsa:6532, (RefSeq) solute carrier family 6 member 40.8071known
D07976, Flupentixol decanoatehsa:1813, (RefSeq) dopamine receptor D20.807known
D06671, Yohimbine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.807known
D02626, Bromperidol decanoate hsa:1813, (RefSeq) dopamine receptor D20.807known
D00284, Cosyntropin hsa:4159, (RefSeq) melanocortin 3 receptor0.8069known
D02108, Indium In 111 pentetreotide hsa:6751, (RefSeq) somatostatin receptor 10.8069known
D00945, Pioglitazone hydrochloride hsa:5468, (RefSeq) peroxisome proliferator activated receptor gamma0.8069known
D05740, Rizatriptan sulfate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8068known
D09794, Norepinephrine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8068known
D07402, Levocetirizine hsa:3269, (RefSeq) histamine receptor H10.8068known
D00329, Flurazepam hsa:2741, (RefSeq) glycine receptor alpha 10.8067training - new
D07662, Cetirizine hsa:3269, (RefSeq) histamine receptor H10.8067known
D02149, Epinephrine bitartrate hsa:152, (RefSeq) adrenoceptor alpha 2C0.8066known
D03914, Dronedarone hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.8066known
D03742, Dextromethorphan hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.8065known
D02034, Setiptiline maleate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8064known
D08255, Naratriptan hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8063known
D00550, Midazolam hsa:2741, (RefSeq) glycine receptor alpha 10.8063training - new
D07660, Celiprolol hsa:153, (RefSeq) adrenoceptor beta 10.8062known
D05601, Prednicarbate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8062known
D00284, Cosyntropin hsa:4160, (RefSeq) melanocortin 4 receptor0.8062known
D00999, Acetylcholine chloride hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.8062known
D00397, Tropicamide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.8061known
D08655, Tubocurarine chloride hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.806new - training
D08378, Pioglitazone hsa:5468, (RefSeq) peroxisome proliferator activated receptor gamma0.8059known
D08118, Levocetirizine dihydrochloride hsa:3269, (RefSeq) histamine receptor H10.8058known
D01428, Fenoterol hydrobromide hsa:154, (RefSeq) adrenoceptor beta 20.8058known
D00680, Methylergonovine maleate hsa:1813, (RefSeq) dopamine receptor D20.8058known
D00774, Orphenadrine citrate hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8058known
D02616, Pagoclone hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.8057known
D00075, Testosterone hsa:367, (RefSeq) androgen receptor0.8057known
D01965, Silodosin hsa:148, (RefSeq) adrenoceptor alpha 1A0.8057known
D02102, Methadone hydrochloride hsa:2903, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2A0.8057known
D01397, Ampiroxicam hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8057known
D02098, Proparacaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8056known
D00570, Colchicine hsa:81027, (RefSeq) tubulin beta 1 class VI0.8056known
D04116, Eucatropine hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8056known
D00999, Acetylcholine chloride hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.8055known
D03914, Dronedarone hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.8055known
D01685, Cetrorelix acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8054known
D02248, Levomepromazine maleate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8054known
D06673, Meprednisone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8054known
D02537, Dronedarone hsa:3757, (RefSeq) potassium voltage-gated channel subfamily H member 20.8052known
D00124, Ephedrine hsa:155, (RefSeq) adrenoceptor beta 30.8052known
D05366, Procaterol hydrochloride hydrate hsa:154, (RefSeq) adrenoceptor beta 20.8052known
D08031, Guanfacine hsa:150, (RefSeq) adrenoceptor alpha 2A0.8051known
D08085, Iproniazid phosphatehsa:4128, (RefSeq) monoamine oxidase A0.805known
D08638, Trihexyphenidyl hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.805known
D04883, Medetomidine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.805known
D08449, Pseudoephedrine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8049known
D01382, Metharbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.8049new - training
D00397, Tropicamide hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8049known
D00570, Colchicine hsa:10381, (RefSeq) tubulin beta 3 class III0.8049known
D00293, Diazepam hsa:8001, (RefSeq) glycine receptor alpha 30.8049training - new
D02535, Timepidium bromide hydrate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.8048known
D00524, Carbachol hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8048known
D00283, Clozapine hsa:147, (RefSeq) adrenoceptor alpha 1B0.8048known
D02207, Tubocurarine chloride hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.8048known
D00397, Tropicamide hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.8048known
D07603, Caffeine citrate hsa:135, (RefSeq) adenosine A2a receptor0.8047new - training
D00313, Ethacrynic acid hsa:6558, (RefSeq) solute carrier family 12 member 20.8047known
D00284, Cosyntropin hsa:4161, (RefSeq) melanocortin 5 receptor0.8045known
D08511, Setiptiline hsa:146, (RefSeq) adrenoceptor alpha 1D0.8045known
D01973, Eletriptan hydrobromide hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8045known
D01236, Conivaptan hydrochloride hsa:553, (RefSeq) arginine vasopressin receptor 1B0.8044known
D05008, Metoclopramide hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8043known
D03496, Cilansetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.8043known
D06104, Theophylline sodium glycinate hsa:134, (RefSeq) adenosine A1 receptor0.8043known
D02374, Metipranolol hsa:154, (RefSeq) adrenoceptor beta 20.8043known
D04531, Indoramin hsa:146, (RefSeq) adrenoceptor alpha 1D0.8042known
D00738, Mepivacaine hydrochloride hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.8042known
D01520, Levomepromazine hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8041known
D02616, Pagoclone hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.8041known
D01712, Theophylline sodium acetate hsa:134, (RefSeq) adenosine A1 receptor0.804known
D00741, Tetracaine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.804known
D01347, Tramazoline hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8039known
D02327, Doxylamine succinate hsa:3269, (RefSeq) histamine receptor H10.8038known
D00509, Phentolamine mesylate hsa:152, (RefSeq) adrenoceptor alpha 2C0.8037known
D03182, Butalbital hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.8037new - training
D03274, Chlorpromazine hibenzate hsa:3269, (RefSeq) histamine receptor H10.8035known
D08049, Hydroquinidine hydrochloridehsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.8035new - training
D08192, Metaraminol hsa:148, (RefSeq) adrenoceptor alpha 1A0.8035known
D03180, Butabarbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.8035new - training
D02995, Asenapine maleate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.8035known
D00283, Clozapine hsa:148, (RefSeq) adrenoceptor alpha 1A0.8035known
D08456, Quetiapine hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8034known
D00597, Acebutolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8034known
D08571, Terlipressin acetate hsa:552, (RefSeq) arginine vasopressin receptor 1A0.8033known
D00784, Ropinirole hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.8033known
D03182, Butalbital hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.8033new - training
D00634, Bisoprolol fumarate hsa:153, (RefSeq) adrenoceptor beta 10.8032known
D08054, Hydroxyzine hsa:3269, (RefSeq) histamine receptor H10.8032known
D08355, Pheniramine hsa:3269, (RefSeq) histamine receptor H10.8032known
D07406, Pimethixene hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.8032known
D00255, Carvedilol hsa:153, (RefSeq) adrenoceptor beta 10.8031known
D08215, Mexiletine hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.8031known
D03914, Dronedarone hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.8031known
D01989, Estriol diacetate benzoate hsa:2099, (RefSeq) estrogen receptor 10.8029known
D00969, Meloxicam hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.8029known
D00632, Dobutamine hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.8029known
D00376, Meprobamate hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8029known
D04018, Ephedrine sulfate hsa:154, (RefSeq) adrenoceptor beta 20.8028known
D01242, Promethazine teoclate hsa:3269, (RefSeq) histamine receptor H10.8028known
D08456, Quetiapine hsa:1814, (RefSeq) dopamine receptor D30.8028known
D06103, Theophylline hsa:134, (RefSeq) adenosine A1 receptor0.8028known
D00594, Repaglinide hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.8027known
D02287, Clocortolone pivalate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8027known
D00494, Promethazine hsa:3269, (RefSeq) histamine receptor H10.8027known
D00674, Naratriptan hydrochloride hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8026known
D00680, Methylergonovine maleate hsa:3354, (RefSeq) 5-hydroxytryptamine receptor 1E0.8026known
D07887, Eletriptan hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8026known
D01604, Efonidipine hydrochloride ethanolate hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.8026known
D01163, Ergonovine maleate hsa:1813, (RefSeq) dopamine receptor D20.8026known
D00498, Pentazocine hsa:4988, (RefSeq) opioid receptor mu 10.8026known
D00329, Flurazepam hsa:8001, (RefSeq) glycine receptor alpha 30.8025training - new
D00999, Acetylcholine chloride hsa:1140, (RefSeq) cholinergic receptor nicotinic beta 1 subunit0.8025known
D05649, Pseudoephedrine sulfate hsa:150, (RefSeq) adrenoceptor alpha 2A0.8025known
D08349, Phenelzine hsa:4128, (RefSeq) monoamine oxidase A0.8024known
D07217, Quinagolide hsa:1813, (RefSeq) dopamine receptor D20.8024known
D00769, Clopidogrel bisulfate hsa:64805, (RefSeq) purinergic receptor P2Y120.8024known
D01500, Trimebutine maleate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.8023known
D02995, Asenapine maleate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.8022known
D01989, Estriol diacetate benzoate hsa:2100, (RefSeq) estrogen receptor 20.8022known
D00550, Midazolam hsa:8001, (RefSeq) glycine receptor alpha 30.8021training - new
D00376, Meprobamate hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8021known
D00507, Phenoxybenzamine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.802known
D04018, Ephedrine sulfate hsa:148, (RefSeq) adrenoceptor alpha 1A0.8019known
D01352, Dinoprost tromethamine hsa:5737, (RefSeq) prostaglandin F receptor0.8019known
D01263, Ritodrine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.8019known
D08649, Triptorelin acetatehsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8019known
D03182, Butalbital hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.8018new - training
D03492, Cifenline hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.8018known
D00789, Chlorpromazine hydrochloride hsa:3357, (RefSeq) 5-hydroxytryptamine receptor 2B0.8018known
D08377, Pilsicainide hsa:3737, (RefSeq) potassium voltage-gated channel subfamily A member 20.8017known
D03415, Carvedilol phosphate hsa:155, (RefSeq) adrenoceptor beta 30.8017known
D04532, Indoramin hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.8016known
D01397, Ampiroxicam hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.8016known
D00511, Phenylephrine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8015known
D07872, Dosulepin hsa:6532, (RefSeq) solute carrier family 6 member 40.8015known
D00095, Epinephrine hsa:155, (RefSeq) adrenoceptor beta 30.8014known
D01230, Flunitrazepam hsa:2741, (RefSeq) glycine receptor alpha 10.8014training - new
D02338, Acebutolol hsa:153, (RefSeq) adrenoceptor beta 10.8013known
D07520, Bepridil hsa:3762, (RefSeq) potassium inwardly rectifying channel subfamily J member 50.8013known
D07729, Clopidogrel hsa:64805, (RefSeq) purinergic receptor P2Y120.8013known
D08041, Homochlorcyclizine hsa:3269, (RefSeq) histamine receptor H10.8013known
D01468, Nemonapride hsa:1813, (RefSeq) dopamine receptor D20.8012known
D01713, Epinastine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.8012known
D05729, Rimexolone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.8012known
D01684, Ozagrel sodium hsa:6916, (RefSeq) thromboxane A synthase 10.8011known
D08901, Degarelix hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.8011known
D00376, Meprobamate hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.8011known
D07665, Cetrorelix hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.801known
D08947, Motesanib diphosphate hsa:3815, (RefSeq) KIT proto-oncogene0.8009known
D02211, Dihydroergotamine mesylate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8009known
D03622, Cyclizine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.8008known
D01340, Naloxone hydrochloride hsa:4988, (RefSeq) opioid receptor mu 10.8008known
D00532, Glutethimide hsa:2566, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma20.8008known
D03914, Dronedarone hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.8007known
D00376, Meprobamate hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.8005known
D02995, Asenapine maleate hsa:1813, (RefSeq) dopamine receptor D20.8004known
D01028, Ticlopidine hydrochloride hsa:64805, (RefSeq) purinergic receptor P2Y120.8004known
D00485, Pseudoephedrine hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.8004known
D03182, Butalbital hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.8004new - training
D08682, Warfarin hsa:1728, (RefSeq) NAD(P)H quinone dehydrogenase 10.8003known
D00987, Cabergoline hsa:1813, (RefSeq) dopamine receptor D20.8003known
D01445, Ifenprodil tartrate hsa:146, (RefSeq) adrenoceptor alpha 1D0.8003known
D06671, Yohimbine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.8002known
D03503, Cimetidine hydrochloride hsa:3274, (RefSeq) histamine receptor H20.8002known
D04034, Chlorpromazine phenolphthalinate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.8002known
D08362, Phentolamine hsa:146, (RefSeq) adrenoceptor alpha 1D0.8001known
D03914, Dronedarone hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.8known
D00376, Meprobamate hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.8known
D01299, Chlormadinone acetate hsa:5241, (RefSeq) progesterone receptor0.7999known
D02131, Tegafur and uracilhsa:7298, (RefSeq) thymidylate synthetase0.7998known
D01672, Gabexate mesilate hsa:3818, (RefSeq) kallikrein B10.7997known
D01323, Azosemide hsa:6558, (RefSeq) solute carrier family 12 member 20.7997known
D00485, Pseudoephedrine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.7996known
D01683, Ozagrel hydrochloride hydrate hsa:6916, (RefSeq) thromboxane A synthase 10.7996known
D08635, Degarelix acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.7996known
D00566, Sodium salicylate hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.7996known
D00422, Ranitidine hsa:3274, (RefSeq) histamine receptor H20.7995known
D01386, Ephedrine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.7995known
D03402, Carbuterol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7995known
D08192, Metaraminol hsa:147, (RefSeq) adrenoceptor alpha 1B0.7994known
D09333, Dutogliptin hsa:1803, (RefSeq) dipeptidyl peptidase 40.7993known
D07670, Chlormadinone hsa:5241, (RefSeq) progesterone receptor0.7993known
D01358, Mianserin hydrochloride hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.7992known
D05649, Pseudoephedrine sulfate hsa:155, (RefSeq) adrenoceptor beta 30.7991known
D08215, Mexiletine hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.7991known
D08004, Gabexate hsa:3818, (RefSeq) kallikrein B10.7991known
D01491, Butropium bromide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7991known
D00199, Ajmaline hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.7991known
D01896, Cilostazol hsa:5140, (RefSeq) phosphodiesterase 3B0.799known
D00532, Glutethimide hsa:2558, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha50.799known
D07793, Desvenlafaxine hsa:6532, (RefSeq) solute carrier family 6 member 40.799known
D04508, Imazodan hydrochloride hsa:5140, (RefSeq) phosphodiesterase 3B0.7989known
D00605, Guanabenz acetate hsa:152, (RefSeq) adrenoceptor alpha 2C0.7989known
D02535, Timepidium bromide hydrate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.7988known
D07445, Amfetamine hsa:6530, (RefSeq) solute carrier family 6 member 20.7988known
D03182, Butalbital hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.7987new - training
D08687, Ziprasidone hsa:1813, (RefSeq) dopamine receptor D20.7987known
D02616, Pagoclone hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.7987known
D00848, Dextromethorphan hydrobromide hsa:2902, (RefSeq) glutamate ionotropic receptor NMDA type subunit 10.7986known
D00505, Phenelzine sulfate hsa:4128, (RefSeq) monoamine oxidase A0.7985known
D05111, Nalmefene hsa:4988, (RefSeq) opioid receptor mu 10.7984known
D00095, Epinephrine hsa:153, (RefSeq) adrenoceptor beta 10.7984known
D00110, Cocaine hsa:6531, (RefSeq) solute carrier family 6 member 30.7984known
D02090, Cyclizine lactate hsa:3269, (RefSeq) histamine receptor H10.7984known
D00606, Guanfacine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.7982known
D04883, Medetomidine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.7982known
D08327, Ozagrel hsa:6916, (RefSeq) thromboxane A synthase 10.7981known
D02102, Methadone hydrochloride hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.7981known
D03658, Dasatinib hsa:3815, (RefSeq) KIT proto-oncogene0.7981known
D00376, Meprobamate hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.7979known
D05374, Paroxetine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.7979known
D01229, Paramethasone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7979known
D03182, Butalbital hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.7978new - training
D00376, Meprobamate hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.7978known
D01269, Solifenacin succinate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7977known
D00303, Disopyramide hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.7977known
D02260, Paroxetine hydrochloride hemihydrate hsa:6532, (RefSeq) solute carrier family 6 member 40.7977known
D00376, Meprobamate hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.7977known
D01336, Carbinoxamine maleate hsa:3269, (RefSeq) histamine receptor H10.7975known
D00304, Divalproex sodium hsa:18, (RefSeq) 4-aminobutyrate aminotransferase0.7975known
D03062, Bazedoxifene acetate hsa:2099, (RefSeq) estrogen receptor 10.7975known
D01230, Flunitrazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7973training - new
D08655, Tubocurarine chloride hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.7973new - training
D07837, Dihydroergotamine hsa:146, (RefSeq) adrenoceptor alpha 1D0.7973known
D00774, Orphenadrine citrate hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.7972known
D08511, Setiptiline hsa:152, (RefSeq) adrenoceptor alpha 2C0.7972known
D08215, Mexiletine hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.7972known
D00532, Glutethimide hsa:2555, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha20.7972known
D03082, Benserazide hsa:1644, (RefSeq) dopa decarboxylase0.7972known
D00169, Meclofenamate sodium hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.7972known
D00538, Zonisamide hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.7971known
D00539, Ethosuximide hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.7971known
D00596, Rosiglitazone maleate hsa:5468, (RefSeq) peroxisome proliferator activated receptor gamma0.7971known
D01111, Nateglinide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.797known
D03182, Butalbital hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.797new - training
D00283, Clozapine hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.797known
D05246, Olmesartan hsa:185, (RefSeq) angiotensin II receptor type 10.797known
D00539, Ethosuximide hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.7969known
D08514, Sildenafil hsa:8654, (RefSeq) phosphodiesterase 5A0.7969known
D03182, Butalbital hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.7969new - training
D00255, Carvedilol hsa:155, (RefSeq) adrenoceptor beta 30.7969known
D00681, Methysergide maleate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.7969known
D00370, Temazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7969training - new
D01382, Metharbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.7968new - training
D06060, Teludipine hydrochloride hsa:775, (RefSeq) calcium voltage-gated channel subunit alpha1 C0.7968new - training
D00454, Olanzapine hsa:3269, (RefSeq) histamine receptor H10.7968known
D05340, Paliperidone palmitate hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.7967known
D00532, Glutethimide hsa:2559, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha60.7967known
D00081, Dinoprost hsa:5737, (RefSeq) prostaglandin F receptor0.7967known
D00532, Glutethimide hsa:2565, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma10.7966known
D08250, Nandrolone hsa:367, (RefSeq) androgen receptor0.7966known
D03062, Bazedoxifene acetate hsa:2100, (RefSeq) estrogen receptor 20.7966known
D01896, Cilostazol hsa:5139, (RefSeq) phosphodiesterase 3A0.7966known
D02074, Amphetamine sulfate hsa:6532, (RefSeq) solute carrier family 6 member 40.7966known
D05206, Norepinephrine bitartrate hsa:155, (RefSeq) adrenoceptor beta 30.7965known
D04508, Imazodan hydrochloride hsa:5139, (RefSeq) phosphodiesterase 3A0.7965known
D00532, Glutethimide hsa:2560, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta10.7965known
D01604, Efonidipine hydrochloride ethanolate hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.7965known
D01236, Conivaptan hydrochloride hsa:552, (RefSeq) arginine vasopressin receptor 1A0.7964known
D07748, Conivaptan hsa:553, (RefSeq) arginine vasopressin receptor 1B0.7964known
D00643, Quinidine polygalacturonatehsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.7963known
D03914, Dronedarone hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.7963known
D00376, Meprobamate hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.7963known
D08305, Orphenadrine hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.7963known
D07511, Benzatropine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7962known
D00532, Glutethimide hsa:2554, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha10.7961known
D00531, Nitrazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7961training - new
D02207, Tubocurarine chloride hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.7961known
D03879, Dobutamine hsa:153, (RefSeq) adrenoceptor beta 10.7961known
D01965, Silodosin hsa:147, (RefSeq) adrenoceptor alpha 1B0.7959known
D05453, Phencyclidine hydrochloride hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.7957known
D02349, Dipivefrin hsa:151, (RefSeq) adrenoceptor alpha 2B0.7956known
D00509, Phentolamine mesylate hsa:146, (RefSeq) adrenoceptor alpha 1D0.7956known
D00371, Theophylline hsa:134, (RefSeq) adenosine A1 receptor0.7955known
D00076, Noradrenaline hsa:154, (RefSeq) adrenoceptor beta 20.7955known
D05312, Oxycodone hsa:4988, (RefSeq) opioid receptor mu 10.7955known
D03182, Butalbital hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.7954new - training
D02017, Oxtriphylline hsa:134, (RefSeq) adenosine A1 receptor0.7954known
D07805, Dexfenfluramine hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.7953known
D00448, Sulfasalazine hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.7953known
D00594, Repaglinide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.7953known
D08249, Naloxone hsa:4988, (RefSeq) opioid receptor mu 10.7953known
D03697, Desoximetasone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7953known
D03182, Butalbital hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.7952new - training
D08362, Phentolamine hsa:152, (RefSeq) adrenoceptor alpha 2C0.7952known
D04226, Flupirtine maleate hsa:2906, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2D0.7951known
D00295, Cimetidine hsa:3274, (RefSeq) histamine receptor H20.7951known
D00532, Glutethimide hsa:2561, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta20.7951known
D00636, Amiodarone hydrochloride hsa:3762, (RefSeq) potassium inwardly rectifying channel subfamily J member 50.795known
D08638, Trihexyphenidyl hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.795known
D02981, Arformoterol tartrate hsa:154, (RefSeq) adrenoceptor beta 20.795known
D08432, Promethazine maleatehsa:3269, (RefSeq) histamine receptor H10.7948known
D01293, Ethyl loflazepate hsa:2741, (RefSeq) glycine receptor alpha 10.7948training - new
D02760, Acrivastine hsa:3269, (RefSeq) histamine receptor H10.7946known
D01360, Clenbuterol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7946known
D01657, Lormetazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7944training - new
D02910, Amiodarone hsa:153, (RefSeq) adrenoceptor beta 10.7943known
D05380, Pazopanib hydrochloride hsa:3791, (RefSeq) kinase insert domain receptor0.7943known
D05380, Pazopanib hydrochloride hsa:3815, (RefSeq) KIT proto-oncogene0.7943known
D06060, Teludipine hydrochloride hsa:776, (RefSeq) calcium voltage-gated channel subunit alpha1 D0.7943new - training
D04018, Ephedrine sulfate hsa:151, (RefSeq) adrenoceptor alpha 2B0.7942known
D00843, Nalbuphine hydrochloride hsa:4988, (RefSeq) opioid receptor mu 10.7942known
D03742, Dextromethorphan hsa:2902, (RefSeq) glutamate ionotropic receptor NMDA type subunit 10.7942known
D02824, Almotriptan hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.7941known
D00999, Acetylcholine chloride hsa:1136, (RefSeq) cholinergic receptor nicotinic alpha 3 subunit0.7941known
D00532, Glutethimide hsa:2556, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha30.794known
D00778, Benztropine mesylate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7939known
D00397, Tropicamide hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.7939known
D00726, Metoclopramide hsa:1813, (RefSeq) dopamine receptor D20.7937known
D04018, Ephedrine sulfate hsa:146, (RefSeq) adrenoceptor alpha 1D0.7937known
D00566, Sodium salicylate hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.7935known
D00774, Orphenadrine citrate hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.7933known
D08162, Meclofenamate sodiumhsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.7933new - training
D01280, Warfarin potassium hsa:1728, (RefSeq) NAD(P)H quinone dehydrogenase 10.7932known
D02066, Isoproterenol sulfate hsa:155, (RefSeq) adrenoceptor beta 30.7932known
D08611, Tizanidine hsa:152, (RefSeq) adrenoceptor alpha 2C0.7932known
D03198, Butoxamine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.793known
D07978, Flupirtine hsa:2906, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2D0.793new - training
D00842, Morphine sulfate hsa:4988, (RefSeq) opioid receptor mu 10.793known
D00370, Temazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7927training - new
D08489, Ropinirole hsa:1813, (RefSeq) dopamine receptor D20.7927known
D09400, Degarelix acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.7926known
D00661, Cevimeline hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7926known
D01689, Loteprednol etabonate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7924known
D06060, Teludipine hydrochloride hsa:778, (RefSeq) calcium voltage-gated channel subunit alpha1 F0.7924new - training
D03535, Clemastine hsa:3269, (RefSeq) histamine receptor H10.7924known
D03106, Bexarotene hsa:6257, (RefSeq) retinoid X receptor beta0.7923known
D05511, Piroxicam betadex hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.7922known
D08305, Orphenadrine hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.7922known
D05649, Pseudoephedrine sulfate hsa:153, (RefSeq) adrenoceptor beta 10.7921known
D01520, Levomepromazine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.792known
D00531, Nitrazepam hsa:8001, (RefSeq) glycine receptor alpha 30.792training - new
D00669, Diphenhydramine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.792known
D07086, Rivaroxaban hsa:2159, (RefSeq) coagulation factor X0.7919known
D00741, Tetracaine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.7918known
D08578, Tetryzoline hsa:146, (RefSeq) adrenoceptor alpha 1D0.7917known
D00538, Zonisamide hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.7917known
D00675, Rizatriptan benzoate hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.7917known
D00606, Guanfacine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.7917known
D02149, Epinephrine bitartrate hsa:154, (RefSeq) adrenoceptor beta 20.7916known
D04302, Ganirelix acetate hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.7915known
D06396, Renzapride hsa:3359, (RefSeq) 5-hydroxytryptamine receptor 3A0.7915known
D08205, Methyldopa hsa:151, (RefSeq) adrenoceptor alpha 2B0.7915known
D08457, Quinagolide hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.7913known
D01521, Pipethanate hydrochloride hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7912known
D00663, Brompheniramine maleate hsa:3269, (RefSeq) histamine receptor H10.7912known
D00563, Mirtazapine hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.7912known
D08572, Tertatolol hydrochloridehsa:154, (RefSeq) adrenoceptor beta 20.7912known
D08953, Nilotinib hsa:25, (RefSeq) ABL proto-oncogene 10.7911known
D00604, Clonidine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.791known
D00816, Nortriptyline hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.791known
D02404, Procaterol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7909known
D03881, Dobutamine tartrate hsa:153, (RefSeq) adrenoceptor beta 10.7909known
D00448, Sulfasalazine hsa:5742, (RefSeq) prostaglandin-endoperoxide synthase 10.7909known
D00480, Promethazine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.7908known
D02612, Thiothixene hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.7908known
D02616, Pagoclone hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.7908known
D02349, Dipivefrin hsa:147, (RefSeq) adrenoceptor alpha 1B0.7907known
D01293, Ethyl loflazepate hsa:8001, (RefSeq) glycine receptor alpha 30.7907training - new
D07928, Ethinylestradiol propanesulfonatehsa:2099, (RefSeq) estrogen receptor 10.7907known
D04116, Eucatropine hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7906known
D08456, Quetiapine hsa:148, (RefSeq) adrenoceptor alpha 1A0.7906known
D01386, Ephedrine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.7906known
D00485, Pseudoephedrine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.7906known
D00676, Sumatriptan succinate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.7906known
D02087, Moricizine hydrochloride hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.7905known
D00787, Trihexyphenidyl hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7905known
D01301, Methenolone enanthate hsa:367, (RefSeq) androgen receptor0.7904known
D00376, Meprobamate hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.7904known
D02995, Asenapine maleate hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.7903known
D02248, Levomepromazine maleate hsa:147, (RefSeq) adrenoceptor alpha 1B0.7903known
D02363, Ketanserin hsa:147, (RefSeq) adrenoceptor alpha 1B0.7903known
D00648, Ibutilide fumarate hsa:3757, (RefSeq) potassium voltage-gated channel subfamily H member 20.7902known
D00973, Cortisone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7902known
D04882, Medazepam hydrochloride hsa:2741, (RefSeq) glycine receptor alpha 10.7902training - new
D01657, Lormetazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7902training - new
D01390, Isoproterenol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7901known
D02102, Methadone hydrochloride hsa:2906, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2D0.7901known
D00765, Rocuronium bromide hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.79known
D03496, Cilansetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.7899known
D07928, Ethinylestradiol propanesulfonatehsa:2100, (RefSeq) estrogen receptor 20.7899known
D00836, Buprenorphine hydrochloride hsa:4988, (RefSeq) opioid receptor mu 10.7899known
D02995, Asenapine maleate hsa:3354, (RefSeq) 5-hydroxytryptamine receptor 1E0.7898known
D00169, Meclofenamate sodium hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.7897known
D00682, Carboprost tromethamine hsa:5737, (RefSeq) prostaglandin F receptor0.7897known
D02969, Aprindine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.7896known
D01692, Alfuzosin hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.7896known
D02632, Indisetron hydrochloride hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.7895known
D01002, Cyclopentolate hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.7895known
D00532, Glutethimide hsa:2562, (RefSeq) gamma-aminobutyric acid type A receptor subunit beta30.7894known
D06396, Renzapride hsa:9177, (RefSeq) 5-hydroxytryptamine receptor 3B0.7894known
D08222, Milnacipran hsa:6532, (RefSeq) solute carrier family 6 member 40.7893known
D05206, Norepinephrine bitartrate hsa:153, (RefSeq) adrenoceptor beta 10.7893known
D00538, Zonisamide hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.7893known
D08358, Phenoxybenzamine hsa:152, (RefSeq) adrenoceptor alpha 2C0.7893known
D05206, Norepinephrine bitartrate hsa:151, (RefSeq) adrenoceptor alpha 2B0.7892known
D01386, Ephedrine hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.7892known
D00999, Acetylcholine chloride hsa:1143, (RefSeq) cholinergic receptor nicotinic beta 4 subunit0.7891known
D00522, Candesartan hsa:185, (RefSeq) angiotensin II receptor type 10.789known
D00376, Meprobamate hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.7889known
D02558, Rivastigmine tartratehsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.7889known
D05453, Phencyclidine hydrochloride hsa:2902, (RefSeq) glutamate ionotropic receptor NMDA type subunit 10.7889known
D07460, Apomorphine hsa:1813, (RefSeq) dopamine receptor D20.7889known
D02074, Amphetamine sulfate hsa:6530, (RefSeq) solute carrier family 6 member 20.7888known
D04018, Ephedrine sulfate hsa:153, (RefSeq) adrenoceptor beta 10.7887known
D07748, Conivaptan hsa:552, (RefSeq) arginine vasopressin receptor 1A0.7886known
D07483, Azelastine hsa:3269, (RefSeq) histamine receptor H10.7886known
D00631, Bepridil hydrochloride hsa:3762, (RefSeq) potassium inwardly rectifying channel subfamily J member 50.7886known
D01454, Bupranolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.7884known
D08305, Orphenadrine hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7884known
D02995, Asenapine maleate hsa:151, (RefSeq) adrenoceptor alpha 2B0.7884known
D08066, Imatinib hsa:25, (RefSeq) ABL proto-oncogene 10.7884known
D01520, Levomepromazine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.7884known
D08655, Tubocurarine chloride hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.7883new - training
D07448, Amitriptyline hsa:6532, (RefSeq) solute carrier family 6 member 40.7883known
D00694, Clorazepate dipotassium hsa:2741, (RefSeq) glycine receptor alpha 10.7883training - new
D01512, Befunolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7882known
D04034, Chlorpromazine phenolphthalinate hsa:152, (RefSeq) adrenoceptor alpha 2C0.7882known
D07406, Pimethixene hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7881known
D00713, Thiamylal sodium hsa:2741, (RefSeq) glycine receptor alpha 10.7881training - new
D00733, Dibucaine hsa:6336, (RefSeq) sodium voltage-gated channel alpha subunit 100.7879known
D00405, Methyldopa hsa:151, (RefSeq) adrenoceptor alpha 2B0.7878known
D00532, Glutethimide hsa:2567, (RefSeq) gamma-aminobutyric acid type A receptor subunit gamma30.7877known
D01444, Bunitrolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.7877known
D00600, Labetalol hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.7876known
D03759, Diacetolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7875known
D00695, Flurazepam hydrochloride hsa:2741, (RefSeq) glycine receptor alpha 10.7875training - new
D00095, Epinephrine hsa:151, (RefSeq) adrenoceptor alpha 2B0.7873known
D04672, Lasofoxifene tartrate hsa:2099, (RefSeq) estrogen receptor 10.7872known
D02349, Dipivefrin hsa:150, (RefSeq) adrenoceptor alpha 2A0.7872known
D05111, Nalmefene hsa:4986, (RefSeq) opioid receptor kappa 10.7872known
D02207, Tubocurarine chloride hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.7872known
D06060, Teludipine hydrochloride hsa:779, (RefSeq) calcium voltage-gated channel subunit alpha1 S0.7871new - training
D03415, Carvedilol phosphate hsa:147, (RefSeq) adrenoceptor alpha 1B0.787known
D01292, Medazepam hsa:2741, (RefSeq) glycine receptor alpha 10.787training - new
D08648, Triprolidine hsa:3269, (RefSeq) histamine receptor H10.787known
D08205, Methyldopa hsa:150, (RefSeq) adrenoceptor alpha 2A0.7869known
D01019, Metaraminol bitartrate hsa:151, (RefSeq) adrenoceptor alpha 2B0.7869known
D09794, Norepinephrine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7869known
D08610, Tixocortol hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7868known
D00965, Nilutamide hsa:367, (RefSeq) androgen receptor0.7867known
D00671, Fexofenadine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.7865known
D08162, Meclofenamate sodiumhsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.7864new - training
D06672, Terlipressin hsa:553, (RefSeq) arginine vasopressin receptor 1B0.7864known
D04672, Lasofoxifene tartrate hsa:2100, (RefSeq) estrogen receptor 20.7864known
D02349, Dipivefrin hsa:153, (RefSeq) adrenoceptor beta 10.7864known
D04882, Medazepam hydrochloride hsa:8001, (RefSeq) glycine receptor alpha 30.786training - new
D00376, Meprobamate hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.7859known
D07749, Cortisone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7858known
D01309, Doxifluridine hsa:7298, (RefSeq) thymidylate synthetase0.7856known
D04018, Ephedrine sulfate hsa:150, (RefSeq) adrenoceptor alpha 2A0.7856known
D00843, Nalbuphine hydrochloride hsa:4986, (RefSeq) opioid receptor kappa 10.7855known
D07590, Bupranolol hsa:155, (RefSeq) adrenoceptor beta 30.7855known
D00283, Clozapine hsa:1813, (RefSeq) dopamine receptor D20.7854known
D00345, Indapamide hsa:6559, (RefSeq) solute carrier family 12 member 30.7854known
D00364, Loratadine hsa:3269, (RefSeq) histamine receptor H10.7853known
D05740, Rizatriptan sulfate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.7852known
D03218, Axitinib hsa:2324, (RefSeq) fms related receptor tyrosine kinase 40.7852known
D00255, Carvedilol hsa:154, (RefSeq) adrenoceptor beta 20.7852known
D08116, Levobupivacaine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.7851new - training
D01554, Pilsicainide hydrochloride hydrate hsa:3737, (RefSeq) potassium voltage-gated channel subfamily A member 20.7849known
D00650, Bendroflumethiazide hsa:6559, (RefSeq) solute carrier family 12 member 30.7848known
D02042, Olprinone hydrochloride hydrate hsa:5140, (RefSeq) phosphodiesterase 3B0.7847known
D02349, Dipivefrin hsa:155, (RefSeq) adrenoceptor beta 30.7846known
D03914, Dronedarone hydrochloride hsa:3757, (RefSeq) potassium voltage-gated channel subfamily H member 20.7845known
D00101, Vasopressin hsa:553, (RefSeq) arginine vasopressin receptor 1B0.7845known
D02340, Loxapine hsa:1813, (RefSeq) dopamine receptor D20.7844known
D01699, Darifenacin hydrobromide hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7843known
D03213, Apixaban hsa:2159, (RefSeq) coagulation factor X0.7843known
D07463, Arformoterol hsa:154, (RefSeq) adrenoceptor beta 20.7843known
D00820, Trazodone hydrochloride hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.7843known
D00554, Ethinyl estradiol hsa:2099, (RefSeq) estrogen receptor 10.7842known
D07853, Dimetindene hsa:3269, (RefSeq) histamine receptor H10.7842known
D08116, Levobupivacaine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.7842new - training
D08474, Reproterol hsa:154, (RefSeq) adrenoceptor beta 20.7841known
D00847, Oxycodone hydrochloride hsa:4988, (RefSeq) opioid receptor mu 10.7841known
D00741, Tetracaine hydrochloride hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.7841known
D00694, Clorazepate dipotassium hsa:8001, (RefSeq) glycine receptor alpha 30.784training - new
D06171, Tixocortol pivalate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.784known
D08305, Orphenadrine hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.784known
D05380, Pazopanib hydrochloride hsa:2321, (RefSeq) fms related receptor tyrosine kinase 10.784known
D00636, Amiodarone hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.784known
D00485, Pseudoephedrine hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7839known
D01454, Bupranolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7839known
D03492, Cifenline hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.7839known
D07831, Dihydrocodeine hsa:4988, (RefSeq) opioid receptor mu 10.7838known
D00713, Thiamylal sodium hsa:8001, (RefSeq) glycine receptor alpha 30.7838training - new
D08192, Metaraminol hsa:151, (RefSeq) adrenoceptor alpha 2B0.7838known
D05230, Octreotide pamoate hsa:6753, (RefSeq) somatostatin receptor 30.7838known
D06414, Dasatinib hsa:3815, (RefSeq) KIT proto-oncogene0.7838known
D02630, Penfluridol hsa:8911, (RefSeq) calcium voltage-gated channel subunit alpha1 I0.7837known
D02535, Timepidium bromide hydrate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7837known
D08572, Tertatolol hydrochloridehsa:155, (RefSeq) adrenoceptor beta 30.7837known
D00283, Clozapine hsa:146, (RefSeq) adrenoceptor alpha 1D0.7837known
D00643, Quinidine polygalacturonatehsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.7835known
D01002, Cyclopentolate hydrochloride hsa:1129, (RefSeq) cholinergic receptor muscarinic 20.7833known
D01444, Bunitrolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7833known
D00554, Ethinyl estradiol hsa:2100, (RefSeq) estrogen receptor 20.7833known
D01939, Ziprasidone hydrochloride hsa:3357, (RefSeq) 5-hydroxytryptamine receptor 2B0.7833known
D00405, Methyldopa hsa:150, (RefSeq) adrenoceptor alpha 2A0.7832known
D01617, Estradiol dipropionate hsa:2099, (RefSeq) estrogen receptor 10.7832known
D00695, Flurazepam hydrochloride hsa:8001, (RefSeq) glycine receptor alpha 30.7832training - new
D04197, Floxuridine hsa:7298, (RefSeq) thymidylate synthetase0.783known
D02100, Ziprasidone mesylate hsa:3357, (RefSeq) 5-hydroxytryptamine receptor 2B0.783known
D00182, Norethindrone hsa:5241, (RefSeq) progesterone receptor0.783known
D06274, Tafluprost hsa:5737, (RefSeq) prostaglandin F receptor0.783known
D03702, Detomidine hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.7829known
D07227, Ornipressin hsa:553, (RefSeq) arginine vasopressin receptor 1B0.7829known
D05649, Pseudoephedrine sulfate hsa:154, (RefSeq) adrenoceptor beta 20.7828known
D01244, Tegafur hsa:7298, (RefSeq) thymidylate synthetase0.7828known
D01973, Eletriptan hydrobromide hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.7827known
D03182, Butalbital hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.7827new - training
D00674, Naratriptan hydrochloride hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.7826known
D01292, Medazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7826training - new
D06401, Indapamide hydratehsa:6559, (RefSeq) solute carrier family 12 member 30.7825known
D01617, Estradiol dipropionate hsa:2100, (RefSeq) estrogen receptor 20.7825known
D00105, Estradiol hsa:2099, (RefSeq) estrogen receptor 10.7823known
D02042, Olprinone hydrochloride hydrate hsa:5139, (RefSeq) phosphodiesterase 3A0.7823known
D07962, Flecainide hsa:90134, (RefSeq) potassium voltage-gated channel subfamily H member 70.7823known
D01354, Fludiazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7822training - new
D01343, Dimethindene maleate hsa:3269, (RefSeq) histamine receptor H10.7821known
D00532, Glutethimide hsa:2557, (RefSeq) gamma-aminobutyric acid type A receptor subunit alpha40.7821known
D07184, Talinolol hsa:153, (RefSeq) adrenoceptor beta 10.7821known
D08397, Pizotifen malatehsa:3358, (RefSeq) 5-hydroxytryptamine receptor 2C0.7819known
D03182, Butalbital hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.7819new - training
D05649, Pseudoephedrine sulfate hsa:152, (RefSeq) adrenoceptor alpha 2C0.7818known
D00507, Phenoxybenzamine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7818known
D08060, Ibutilide hsa:3757, (RefSeq) potassium voltage-gated channel subfamily H member 20.7817known
D00357, Losartan potassium hsa:185, (RefSeq) angiotensin II receptor type 10.7816known
D03359, Cangrelor hsa:64805, (RefSeq) purinergic receptor P2Y120.7816known
D01347, Tramazoline hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.7816known
D00105, Estradiol hsa:2100, (RefSeq) estrogen receptor 20.7815known
D02995, Asenapine maleate hsa:150, (RefSeq) adrenoceptor alpha 2A0.7815known
D00765, Rocuronium bromide hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.7814known
D08449, Pseudoephedrine hsa:151, (RefSeq) adrenoceptor alpha 2B0.7814known
D08246, Nalbuphine hsa:4988, (RefSeq) opioid receptor mu 10.7814known
D08281, Nomegestrol acetate hsa:5241, (RefSeq) progesterone receptor0.7813known
D07734, Cinnarizine dihydrochloridehsa:3269, (RefSeq) histamine receptor H10.7812known
D05230, Octreotide pamoate hsa:6754, (RefSeq) somatostatin receptor 40.7812known
D08283, Nordazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7812training - new
D00664, Cetirizine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.7811known
D00367, Mazindol hsa:6531, (RefSeq) solute carrier family 6 member 30.7811known
D03658, Dasatinib hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.7811known
D00999, Acetylcholine chloride hsa:1135, (RefSeq) cholinergic receptor nicotinic alpha 2 subunit0.7811known
D02004, Apomorphine hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.781known
D03492, Cifenline hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.781known
D00284, Cosyntropin hsa:4157, (RefSeq) melanocortin 1 receptor0.7809known
D00464, Oxazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7809new - new
D05206, Norepinephrine bitartrate hsa:150, (RefSeq) adrenoceptor alpha 2A0.7808known
D01520, Levomepromazine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.7808known
D03182, Butalbital hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.7808new - training
D05206, Norepinephrine bitartrate hsa:154, (RefSeq) adrenoceptor beta 20.7808known
D03415, Carvedilol phosphate hsa:148, (RefSeq) adrenoceptor alpha 1A0.7808known
D00600, Labetalol hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.7807known
D08377, Pilsicainide hsa:3743, (RefSeq) potassium voltage-gated channel subfamily A member 70.7806known
D05127, Nebivolol hsa:153, (RefSeq) adrenoceptor beta 10.7806known
D06106, Thiamylalhsa:2741, (RefSeq) glycine receptor alpha 10.7806training - new
D07887, Eletriptan hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.7805known
D07784, Delorazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7804training - new
D09918, Latrepirdine dihydrochloride hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.7804known
D09804, Sodium santoninate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7804new - training
D01953, Estradiol benzoate hsa:2099, (RefSeq) estrogen receptor 10.7804known
D07590, Bupranolol hsa:154, (RefSeq) adrenoceptor beta 20.7803known
D02357, Methysergide hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.7803known
D01161, Fulvestrant hsa:2099, (RefSeq) estrogen receptor 10.7801known
D01295, Cinnarizine hsa:3269, (RefSeq) histamine receptor H10.78known
D08215, Mexiletine hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.78known
D03492, Cifenline hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.78known
D00626, Candesartan cilexetil hsa:185, (RefSeq) angiotensin II receptor type 10.7799known
D02720, Beraprost hsa:5739, (RefSeq) prostaglandin I2 receptor0.7797known
D01953, Estradiol benzoate hsa:2100, (RefSeq) estrogen receptor 20.7797known
D07837, Dihydroergotamine hsa:1813, (RefSeq) dopamine receptor D20.7796known
D05380, Pazopanib hydrochloride hsa:2324, (RefSeq) fms related receptor tyrosine kinase 40.7796known
D01192, Olopatadine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.7794known
D02111, Pentazocine lactate hsa:4986, (RefSeq) opioid receptor kappa 10.7794known
D01161, Fulvestrant hsa:2100, (RefSeq) estrogen receptor 20.7794known
D02252, Amobarbital sodium hsa:2741, (RefSeq) glycine receptor alpha 10.7793training - new
D04532, Indoramin hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.7793known
D00315, Etodolac hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.7792known
D00774, Orphenadrine citrate hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7792known
D02834, Alprenoxime hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7791known
D02349, Dipivefrin hsa:148, (RefSeq) adrenoceptor alpha 1A0.779known
D06672, Terlipressin hsa:552, (RefSeq) arginine vasopressin receptor 1A0.7789known
D00533, Oxcarbazepine hsa:6326, (RefSeq) sodium voltage-gated channel alpha subunit 20.7789known
D00986, Fludrocortisone acetate hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7788known
D00284, Cosyntropin hsa:4158, (RefSeq) melanocortin 2 receptor0.7787known
D00095, Epinephrine hsa:150, (RefSeq) adrenoceptor alpha 2A0.7787known
D02182, Cocaine hydrochloride hsa:6531, (RefSeq) solute carrier family 6 member 30.7786known
D08031, Guanfacine hsa:152, (RefSeq) adrenoceptor alpha 2C0.7785known
D00397, Tropicamide hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7784known
D01354, Fludiazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7782training - new
D00101, Vasopressin hsa:552, (RefSeq) arginine vasopressin receptor 1A0.778known
D08010, Ganirelix hsa:2798, (RefSeq) gonadotropin releasing hormone receptor0.7779known
D08638, Trihexyphenidyl hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7778known
D00638, Flecainide acetate hsa:90134, (RefSeq) potassium voltage-gated channel subfamily H member 70.7777known
D01204, Olmesartan medoxomil hsa:185, (RefSeq) angiotensin II receptor type 10.7777known
D02078, Dextroamphetamine sulfate hsa:6531, (RefSeq) solute carrier family 6 member 30.7776known
D00563, Mirtazapine hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.7776known
D00794, Loxapine succinate hsa:1813, (RefSeq) dopamine receptor D20.7776known
D08215, Mexiletine hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.7776known
D07916, Esmolol hsa:153, (RefSeq) adrenoceptor beta 10.7774known
D07967, Fludrocortisone hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7771known
D01504, Bufetolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.7771known
D08283, Nordazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7771training - new
D00458, Quetiapine fumarate hsa:1815, (RefSeq) dopamine receptor D40.777known
D08236, Mosapride hsa:3360, (RefSeq) 5-hydroxytryptamine receptor 40.777known
D00376, Meprobamate hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.777known
D02111, Pentazocine lactate hsa:4988, (RefSeq) opioid receptor mu 10.7769known
D07913, Escitalopram hsa:6532, (RefSeq) solute carrier family 6 member 40.7768known
D01964, Travoprost hsa:5737, (RefSeq) prostaglandin F receptor0.7768known
D00464, Oxazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7768new - new
D02995, Asenapine maleate hsa:152, (RefSeq) adrenoceptor alpha 2C0.7768known
D00485, Pseudoephedrine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7767known
D02388, Levonordefrin hsa:151, (RefSeq) adrenoceptor alpha 2B0.7767known
D00270, Chlorpromazine hsa:3269, (RefSeq) histamine receptor H10.7767known
D00673, Ranitidine hydrochloride hsa:3274, (RefSeq) histamine receptor H20.7766known
D01019, Metaraminol bitartrate hsa:150, (RefSeq) adrenoceptor alpha 2A0.7765known
D06106, Thiamylalhsa:8001, (RefSeq) glycine receptor alpha 30.7765training - new
D03702, Detomidine hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.7764known
D08193, Metenolone hsa:367, (RefSeq) androgen receptor0.7764known
D00095, Epinephrine hsa:154, (RefSeq) adrenoceptor beta 20.7764known
D06413, Nilotinib hydrochloride hydrate hsa:25, (RefSeq) ABL proto-oncogene 10.7763known
D01017, Dipivefrin hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7763known
D02343, Carboprost hsa:5737, (RefSeq) prostaglandin F receptor0.7763known
D07784, Delorazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7763training - new
D00837, Butorphanol tartrate hsa:4986, (RefSeq) opioid receptor kappa 10.7762known
D05230, Octreotide pamoate hsa:6755, (RefSeq) somatostatin receptor 50.7762known
D03274, Chlorpromazine hibenzate hsa:3357, (RefSeq) 5-hydroxytryptamine receptor 2B0.7762known
D08356, Phenobarbital diethylaminehsa:2741, (RefSeq) glycine receptor alpha 10.776training - new
D00507, Phenoxybenzamine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.776known
D01862, Pitavastatin calcium hsa:3156, (RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase0.776known
D01386, Ephedrine hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7759known
D00328, Flurandrenolide hsa:2908, (RefSeq) nuclear receptor subfamily 3 group C member 10.7758known
D00532, Glutethimide hsa:2563, (RefSeq) gamma-aminobutyric acid type A receptor subunit delta0.7756known
D03182, Butalbital hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.7756new - training
D00758, Atracurium besylate hsa:1146, (RefSeq) cholinergic receptor nicotinic gamma subunit0.7756known
D07227, Ornipressin hsa:552, (RefSeq) arginine vasopressin receptor 1A0.7756known
D00487, Pyridostigmine bromide hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.7755known
D07121, Alfatradiol hsa:2099, (RefSeq) estrogen receptor 10.7755new - training
D00999, Acetylcholine chloride hsa:8973, (RefSeq) cholinergic receptor nicotinic alpha 6 subunit0.7755known
D02632, Indisetron hydrochloride hsa:170572, (RefSeq) 5-hydroxytryptamine receptor 3C0.7754known
D00555, Amobarbital hsa:2741, (RefSeq) glycine receptor alpha 10.7754training - new
D00998, Neostigmine methylsulfate hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.7754known
D00376, Meprobamate hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.7754known
D00563, Mirtazapine hsa:151, (RefSeq) adrenoceptor alpha 2B0.7753known
D02252, Amobarbital sodium hsa:8001, (RefSeq) glycine receptor alpha 30.7753training - new
D00124, Ephedrine hsa:154, (RefSeq) adrenoceptor beta 20.7752known
D01441, Imatinib mesylate hsa:25, (RefSeq) ABL proto-oncogene 10.7752known
D05511, Piroxicam betadex hsa:5743, (RefSeq) prostaglandin-endoperoxide synthase 20.7751known
D01321, Zotepine hsa:1813, (RefSeq) dopamine receptor D20.775known
D03740, Dextroamphetamine hsa:6531, (RefSeq) solute carrier family 6 member 30.775known
D05230, Octreotide pamoate hsa:6752, (RefSeq) somatostatin receptor 20.7749known
D07121, Alfatradiol hsa:2100, (RefSeq) estrogen receptor 20.7748new - training
D00365, Lorazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7748training - new
D01174, Pheniramine maleate hsa:3269, (RefSeq) histamine receptor H10.7747known
D00797, Promazine hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.7747known
D00255, Carvedilol hsa:147, (RefSeq) adrenoceptor alpha 1B0.7746known
D08192, Metaraminol hsa:146, (RefSeq) adrenoceptor alpha 1D0.7745known
D07962, Flecainide hsa:81033, (RefSeq) potassium voltage-gated channel subfamily H member 60.7744known
D01740, Barbital hsa:2741, (RefSeq) glycine receptor alpha 10.7744training - new
D06671, Yohimbine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7742known
D00532, Glutethimide hsa:2564, (RefSeq) gamma-aminobutyric acid type A receptor subunit epsilon0.7741known
D00949, Hydroxyprogesterone caproate hsa:5241, (RefSeq) progesterone receptor0.774known
D00726, Metoclopramide hsa:3360, (RefSeq) 5-hydroxytryptamine receptor 40.774known
D01654, Bepotastine besylate hsa:3269, (RefSeq) histamine receptor H10.774known
D02081, Metipranolol hydrochloridehsa:155, (RefSeq) adrenoceptor beta 30.7739known
D05718, Reproterol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7739known
D00995, Neostigmine bromide hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.7738known
D09918, Latrepirdine dihydrochloride hsa:2902, (RefSeq) glutamate ionotropic receptor NMDA type subunit 10.7737known
D01965, Silodosin hsa:146, (RefSeq) adrenoceptor alpha 1D0.7737known
D03170, Bucindolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7737known
D04104, Etonogestrel hsa:5241, (RefSeq) progesterone receptor0.7735known
D08655, Tubocurarine chloride hsa:1140, (RefSeq) cholinergic receptor nicotinic beta 1 subunit0.7734new - training
D04292, Galantamine hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.7733known
D08192, Metaraminol hsa:150, (RefSeq) adrenoceptor alpha 2A0.7733known
D08670, Venlafaxine hsa:6532, (RefSeq) solute carrier family 6 member 40.7733known
D02248, Levomepromazine maleate hsa:148, (RefSeq) adrenoceptor alpha 1A0.7732known
D00765, Rocuronium bromide hsa:1144, (RefSeq) cholinergic receptor nicotinic delta subunit0.7729known
D01386, Ephedrine hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7729known
D00741, Tetracaine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.7728known
D08205, Methyldopa hsa:1644, (RefSeq) dopa decarboxylase0.7727known
D00666, Clemastine fumarate hsa:3269, (RefSeq) histamine receptor H10.7727known
D02087, Moricizine hydrochloride hsa:6328, (RefSeq) sodium voltage-gated channel alpha subunit 30.7726known
D00405, Methyldopa hsa:1644, (RefSeq) dopa decarboxylase0.7726known
D03799, Dienogest hsa:5241, (RefSeq) progesterone receptor0.7725known
D00380, Tolbutamide hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.7725known
D00507, Phenoxybenzamine hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.7724known
D03492, Cifenline hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.7724known
D00280, Clonazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7724training - new
D01485, Propericiazine hsa:1813, (RefSeq) dopamine receptor D20.7723known
D05597, Prasugrel hydrochloride hsa:64805, (RefSeq) purinergic receptor P2Y120.7723known
D05091, Muraglitazar hsa:5468, (RefSeq) peroxisome proliferator activated receptor gamma0.7722known
D02207, Tubocurarine chloride hsa:1140, (RefSeq) cholinergic receptor nicotinic beta 1 subunit0.7722known
D00999, Acetylcholine chloride hsa:1142, (RefSeq) cholinergic receptor nicotinic beta 3 subunit0.7722known
D01179, Duloxetine hydrochloride hsa:6532, (RefSeq) solute carrier family 6 member 40.7722known
D04883, Medetomidine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7721known
D08356, Phenobarbital diethylaminehsa:8001, (RefSeq) glycine receptor alpha 30.7721training - new
D02227, Pentazocine hydrochloride hsa:4986, (RefSeq) opioid receptor kappa 10.772known
D09749, Itasetron hydrochloride hydrate hsa:285242, (RefSeq) 5-hydroxytryptamine receptor 3E0.7718known
D08449, Pseudoephedrine hsa:150, (RefSeq) adrenoceptor alpha 2A0.7718known
D02173, Galantamine hydrobromide hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.7717known
D00600, Labetalol hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.7716known
D03496, Cilansetron hydrochloride hsa:200909, (RefSeq) 5-hydroxytryptamine receptor 3D0.7716known
D08167, Megestrol hsa:5241, (RefSeq) progesterone receptor0.7716known
D02349, Dipivefrin hsa:146, (RefSeq) adrenoceptor alpha 1D0.7714known
D03415, Carvedilol phosphate hsa:154, (RefSeq) adrenoceptor beta 20.7714known
D08195, Methadone hsa:2903, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2A0.7713known
D01521, Pipethanate hydrochloride hsa:1128, (RefSeq) cholinergic receptor muscarinic 10.7713known
D07803, Dexchlorpheniramine hsa:3269, (RefSeq) histamine receptor H10.7712known
D03415, Carvedilol phosphate hsa:146, (RefSeq) adrenoceptor alpha 1D0.7712known
D00844, Oxymorphone hydrochloride hsa:4988, (RefSeq) opioid receptor mu 10.7712known
D00555, Amobarbital hsa:8001, (RefSeq) glycine receptor alpha 30.7712training - new
D01017, Dipivefrin hydrochloride hsa:151, (RefSeq) adrenoceptor alpha 2B0.771known
D08246, Nalbuphine hsa:4986, (RefSeq) opioid receptor kappa 10.7709known
D00365, Lorazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7709training - new
D03880, Dobutamine lactobionate hsa:153, (RefSeq) adrenoceptor beta 10.7708known
D00454, Olanzapine hsa:1815, (RefSeq) dopamine receptor D40.7708known
D00106, Epoprostenol hsa:5739, (RefSeq) prostaglandin I2 receptor0.7707known
D00999, Acetylcholine chloride hsa:1138, (RefSeq) cholinergic receptor nicotinic alpha 5 subunit0.7706known
D02211, Dihydroergotamine mesylate hsa:1813, (RefSeq) dopamine receptor D20.7706known
D03177, Bunolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7706known
D03704, Dexbrompheniramine maleate hsa:3269, (RefSeq) histamine receptor H10.7705known
D01740, Barbital hsa:8001, (RefSeq) glycine receptor alpha 30.7704training - new
D00394, Trimipramine hsa:6530, (RefSeq) solute carrier family 6 member 20.7704known
D02104, Nalmefene hydrochloridehsa:4988, (RefSeq) opioid receptor mu 10.7704known
D00485, Pseudoephedrine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7704known
D00376, Meprobamate hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.7703known
D01017, Dipivefrin hydrochloride hsa:147, (RefSeq) adrenoceptor alpha 1B0.7703known
D01386, Ephedrine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7703known
D08105, Ketotifen hsa:3269, (RefSeq) histamine receptor H10.7703known
D00311, Estazolam hsa:2741, (RefSeq) glycine receptor alpha 10.7703training - new
D02388, Levonordefrin hsa:150, (RefSeq) adrenoceptor alpha 2A0.77known
D01504, Bufetolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7699known
D02409, Caffeine and sodium benzoate hsa:135, (RefSeq) adenosine A2a receptor0.7699new - training
D02087, Moricizine hydrochloride hsa:6335, (RefSeq) sodium voltage-gated channel alpha subunit 90.7698known
D02248, Levomepromazine maleate hsa:151, (RefSeq) adrenoceptor alpha 2B0.7698known
D00675, Rizatriptan benzoate hsa:3351, (RefSeq) 5-hydroxytryptamine receptor 1B0.7696known
D00196, Physostigmine hsa:43, (RefSeq) acetylcholinesterase (Cartwright blood group)0.7695known
D00638, Flecainide acetate hsa:81033, (RefSeq) potassium voltage-gated channel subfamily H member 60.7695known
D00759, Cisatracurium besylate hsa:1134, (RefSeq) cholinergic receptor nicotinic alpha 1 subunit0.7694known
D08305, Orphenadrine hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7694known
D00316, Etretinate hsa:5915, (RefSeq) retinoic acid receptor beta0.7693known
D07519, Benzylthiouracilhsa:1734, (RefSeq) iodothyronine deiodinase 20.7693known
D07519, Benzylthiouracilhsa:1733, (RefSeq) iodothyronine deiodinase 10.7693known
D07984, Fluvoxamine hsa:6532, (RefSeq) solute carrier family 6 member 40.7691known
D08626, Trazodone hsa:3356, (RefSeq) 5-hydroxytryptamine receptor 2A0.769known
D00415, Zolmitriptan hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.769known
D08525, Sotalol hsa:3757, (RefSeq) potassium voltage-gated channel subfamily H member 20.769known
D00532, Glutethimide hsa:2568, (RefSeq) gamma-aminobutyric acid type A receptor subunit pi0.7689known
D08626, Trazodone hsa:6532, (RefSeq) solute carrier family 6 member 40.7689known
D02087, Moricizine hydrochloride hsa:6323, (RefSeq) sodium voltage-gated channel alpha subunit 10.7689known
D01017, Dipivefrin hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.7687known
D01521, Pipethanate hydrochloride hsa:1132, (RefSeq) cholinergic receptor muscarinic 40.7686known
D03562, Clorazepate monopotassium hsa:2741, (RefSeq) glycine receptor alpha 10.7686training - new
D00274, Cisapride hsa:3360, (RefSeq) 5-hydroxytryptamine receptor 40.7686known
D00430, Secobarbital hsa:2741, (RefSeq) glycine receptor alpha 10.7685training - new
D02087, Moricizine hydrochloride hsa:6334, (RefSeq) sodium voltage-gated channel alpha subunit 80.7684known
D00280, Clonazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7683training - new
D03471, Chlorothiazide sodium hsa:6559, (RefSeq) solute carrier family 12 member 30.7682known
D03490, Cicloprolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.7682known
D00255, Carvedilol hsa:148, (RefSeq) adrenoceptor alpha 1A0.768known
D08215, Mexiletine hsa:6331, (RefSeq) sodium voltage-gated channel alpha subunit 50.7679known
D07520, Bepridil hsa:3768, (RefSeq) potassium inwardly rectifying channel subfamily J member 120.7679known
D01520, Levomepromazine hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.7678known
D00563, Mirtazapine hsa:150, (RefSeq) adrenoceptor alpha 2A0.7677known
D01220, Trapidil hsa:6916, (RefSeq) thromboxane A synthase 10.7677known
D05230, Octreotide pamoate hsa:6751, (RefSeq) somatostatin receptor 10.7675known
D06414, Dasatinib hsa:5159, (RefSeq) platelet derived growth factor receptor beta0.7674known
D03182, Butalbital hsa:55879, (RefSeq) gamma-aminobutyric acid type A receptor subunit theta0.7673new - training
D08195, Methadone hsa:2904, (RefSeq) glutamate ionotropic receptor NMDA type subunit 2B0.7672known
D00758, Atracurium besylate hsa:1145, (RefSeq) cholinergic receptor nicotinic epsilon subunit0.7672known
D00457, Quazepam hsa:2741, (RefSeq) glycine receptor alpha 10.767training - new
D02349, Dipivefrin hsa:154, (RefSeq) adrenoceptor beta 20.7666known
D03170, Bucindolol hydrochloride hsa:154, (RefSeq) adrenoceptor beta 20.7665known
D08106, Labetalol hsa:147, (RefSeq) adrenoceptor alpha 1B0.7665known
D00311, Estazolam hsa:8001, (RefSeq) glycine receptor alpha 30.7663training - new
D00836, Buprenorphine hydrochloride hsa:4986, (RefSeq) opioid receptor kappa 10.7663known
D02349, Dipivefrin hsa:152, (RefSeq) adrenoceptor alpha 2C0.7663known
D08996, Saxagliptin hsa:1803, (RefSeq) dipeptidyl peptidase 40.7663known
D02234, Cyproheptadine hydrochloride hsa:3269, (RefSeq) histamine receptor H10.7661known
D01131, Lafutidine hsa:3274, (RefSeq) histamine receptor H20.766known
D01847, Landiolol hydrochloride hsa:153, (RefSeq) adrenoceptor beta 10.766known
D07990, Formoterol hsa:154, (RefSeq) adrenoceptor beta 20.766known
D01310, Secobarbital sodium hsa:2741, (RefSeq) glycine receptor alpha 10.766training - new
D01605, Meticrane hsa:6559, (RefSeq) solute carrier family 12 member 30.7659known
D02599, Orphenadrine hydrochloridehsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7658known
D08233, Morphine hsa:4988, (RefSeq) opioid receptor mu 10.7658known
D00606, Guanfacine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7657known
D00950, Levonorgestrel hsa:5241, (RefSeq) progesterone receptor0.7656known
D01551, Beraprost sodium hsa:5739, (RefSeq) prostaglandin I2 receptor0.7655known
D07997, Frovatriptan hsa:3352, (RefSeq) 5-hydroxytryptamine receptor 1D0.7654known
D02599, Orphenadrine hydrochloridehsa:1128, (RefSeq) cholinergic receptor muscarinic 10.7653known
D02599, Orphenadrine hydrochloridehsa:1132, (RefSeq) cholinergic receptor muscarinic 40.7652known
D07759, Cyclopentolate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7652known
D01002, Cyclopentolate hydrochloride hsa:1133, (RefSeq) cholinergic receptor muscarinic 50.7652known
D01356, Glymidine sodium hsa:6833, (RefSeq) ATP binding cassette subfamily C member 80.7652known
D04018, Ephedrine sulfate hsa:152, (RefSeq) adrenoceptor alpha 2C0.7652known
D00499, Pentobarbital hsa:2741, (RefSeq) glycine receptor alpha 10.7651training - new
D03170, Bucindolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.7651known
D02363, Ketanserin hsa:146, (RefSeq) adrenoceptor alpha 1D0.7651known
D08132, Lisuride hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.765known
D08511, Setiptiline hsa:3357, (RefSeq) 5-hydroxytryptamine receptor 2B0.7648known
D02248, Levomepromazine maleate hsa:146, (RefSeq) adrenoceptor alpha 1D0.7647known
D01522, Tiapride hydrochloride hsa:1813, (RefSeq) dopamine receptor D20.7647known
D03562, Clorazepate monopotassium hsa:8001, (RefSeq) glycine receptor alpha 30.7646training - new
D07667, Cevimeline hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7646known
D00743, Naphazoline hydrochloride hsa:148, (RefSeq) adrenoceptor alpha 1A0.7646known
D00234, Astemizole hsa:3269, (RefSeq) histamine receptor H10.7645known
D03693, Desloratadine hsa:3269, (RefSeq) histamine receptor H10.7644known
D01268, Cloxazolam hsa:2741, (RefSeq) glycine receptor alpha 10.7644training - new
D00430, Secobarbital hsa:8001, (RefSeq) glycine receptor alpha 30.7643training - new
D00195, Codeine hsa:4988, (RefSeq) opioid receptor mu 10.7643known
D08293, Olopatadine hsa:3269, (RefSeq) histamine receptor H10.7642known
D02630, Penfluridol hsa:8912, (RefSeq) calcium voltage-gated channel subunit alpha1 H0.7639known
D02630, Penfluridol hsa:8913, (RefSeq) calcium voltage-gated channel subunit alpha1 G0.7638known
D01994, Mosapride citrate hydrate hsa:3360, (RefSeq) 5-hydroxytryptamine receptor 40.7638known
D08430, Promazine hsa:1813, (RefSeq) dopamine receptor D20.7637new - training
D01462, Lisuride maleate hsa:3350, (RefSeq) 5-hydroxytryptamine receptor 1A0.7637known
D01879, Eptazocine hydrobromide hsa:4986, (RefSeq) opioid receptor kappa 10.7636known
D07904, Eptazocine hsa:4986, (RefSeq) opioid receptor kappa 10.7636known
D02101, Codeine phosphate hsa:4988, (RefSeq) opioid receptor mu 10.7636known
D02249, Emedastine difumarate hsa:3269, (RefSeq) histamine receptor H10.7636known
D05028, Midazolam maleate hsa:2741, (RefSeq) glycine receptor alpha 10.7634training - new
D01512, Befunolol hydrochloride hsa:155, (RefSeq) adrenoceptor beta 30.7634known
D01468, Nemonapride hsa:1814, (RefSeq) dopamine receptor D30.7632known
D08456, Quetiapine hsa:147, (RefSeq) adrenoceptor alpha 1B0.7632known
D04226, Flupirtine maleate hsa:2902, (RefSeq) glutamate ionotropic receptor NMDA type subunit 10.7632known
D00837, Butorphanol tartrate hsa:4988, (RefSeq) opioid receptor mu 10.7631known
D01017, Dipivefrin hydrochloride hsa:150, (RefSeq) adrenoceptor alpha 2A0.763known
D01356, Glymidine sodium hsa:10060, (RefSeq) ATP binding cassette subfamily C member 90.763known
D01593, Nimetazepam hsa:2741, (RefSeq) glycine receptor alpha 10.7629training - new
D00457, Quazepam hsa:8001, (RefSeq) glycine receptor alpha 30.7629training - new
D01520, Levomepromazine hydrochloride hsa:146, (RefSeq) adrenoceptor alpha 1D0.7628known
D03492, Cifenline hsa:6329, (RefSeq) sodium voltage-gated channel alpha subunit 40.7628known
D01520, Levomepromazine hydrochloride hsa:152, (RefSeq) adrenoceptor alpha 2C0.7628known
D01148, Tolterodine tartrate hsa:1131, (RefSeq) cholinergic receptor muscarinic 30.7627known
D00320, Fentanyl hsa:4988, (RefSeq) opioid receptor mu 10.7626known
D02815, Alitretinoin hsa:6256, (RefSeq) retinoid X receptor alpha0.7626known
D02227, Pentazocine hydrochloride