GenomeNet

>cmc:CMN_00844 xylA; hypothetical protein (EC:5.3.1.5); K01805 xylose isomerase [EC:5.3.1.5] (A)
MALTPTREDKFSFGLWTIGYTGADPFGGPTRSDLDVVEGVERISELGAYGLTFHDDDLFA
FGSTDAERQTQIDRLKGALSDTGIVVPMVTTNLFSAPVFKDGGFTSNDRAVRRFAIHKVL
RNIDLAAELGAQTFVMWGGREGAEYDSAKDVRGALERYREAVNLLGDYVTDKGYDIRFAI
EPKPNEPRGDILLPTLGHALAFIETLERPELVGVNPEVGHEQMAGLNFTAGIMQALYQGK
LFHIDLNGQRGIKYDQDLVFGHGDLQNAFSLVDLLENGGVGGGRSYDGPRHFDYKPSRTE
DITGVWDSAAANMRMYLLLKERAQAFRADPEVQEALAAAKVQDIYTPTLDEGESYDDILA
DRSSYEDFAADEYFDAKGFGFVRLNQLALEHLMGARS

BLAST