GenomeNet

>hse:Hsero_0097 tufB; EF-Tu elongation factor protein; K02358 elongation factor Tu (A)
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIIVFLNKADMVDDAELLELVEMEVRELLSKYEFPGDDLPIVKGSAKLALE
GDTGPLGEQAIMALAEALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIADTQKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVQRGQVLAKPGS
IKPHKHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPKDKEMVMPGDNVS
ITVQLINPIAMEEGLRFAIREGGRTVGAGVVAKIFD

BLAST