GenomeNet

>tr:A0A177CP12_9PLEO [A0A177CP12] RecName: Full=Translation machinery-associated protein 22 {ECO:0000256|RuleBase:RU361273};
MTTESYPRTVLYCGVCTLPPEYCEFGGTTKKCEEWLEKNQPELHKKLYSQEALEQNLSSL
SLEAQKRAEKDSQKKAAKAAAAEARDAETRASSKVLIKRIERNKRKYVTAVQGLEAFGLD
IKKVAKDFGKKFATGSSVTKVPGGGEEITVQGDLSDDIQEYIEENYKNVPDDNIELVEDK
KKKKAEQQAV

BLAST