KEGG   Aggregatibacter aphrophilus: NT05HA_0080Help
Entry
NT05HA_0080       CDS       T00929                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NT05HA_0080
Enzymes [BR:aap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NT05HA_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(82950..83909)
Genome map
AA seq 319 aa AA seqDB search
MRSFCSGGNMCAKLVVLGSINVDHVIQVPRFVKAGETLSGSHYRITYGGKGANQAVAAAR
LKAQNTQVDFIACIGHDDIGKAMKNAFAQDGINVTPIRQIENEMSGIAMIQVAESGENSI
VIAAGANAYLDESLVEEQAENIRQADALLMQLETRLAAICYAADIAKQHHTKVILNPAPA
NTLPQTLLANLYMITPNETEAEILTGIKVEDEAGAARAAEKLHHWGVQIVLITLGAKGVY
VSENNQGQIIEGFRVTAKDTTAAGDTFNGALVVSLLEGKSLTDAIRFAHAAAAISVTRAG
AQPSIPNRAETLDFLEKQG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccttttgctcaggaggaaatatgtgcgccaaactcgttgttctcggcagcatt
aacgtcgatcatgttattcaagtaccgcgcttcgtaaaagccggtgaaaccttaagcggt
tcccattatcgcattacttatggtggaaaaggggcgaatcaggcggtggctgcggcacgc
ttaaaagcgcaaaacacacaggtagattttattgcttgcattggccatgatgatattggc
aaggccatgaaaaatgcctttgcgcaagacggcatcaatgtaacgcctattcgccaaatt
gaaaatgaaatgagcggcattgccatgatccaagtggcagagagcggggaaaatagcatt
gttattgccgccggcgccaatgcttatttagatgagtcgttagtggaagaacaggctgaa
aatattcggcaggcagatgctttattaatgcaactggaaacacggctcgccgccatttgt
tacgctgccgacattgctaaacaacatcacactaaagtgattctaaacccagccccggca
aacacgttaccgcaaacgttacttgctaatttatacatgattaccccaaatgagacagaa
gcggaaatcctgacgggaattaaagtggaagatgaagccggtgcagcacgggcagcagag
aaattgcatcattggggagtacaaattgtgctcattacccttggcgccaaaggcgtttat
gtcagtgaaaacaatcaaggacaaattatcgagggctttcgtgtaaccgccaaagacact
acggcggcaggcgatacattcaacggtgcattagtggtgagtttattagaaggtaaaagc
ctcactgacgccatccgttttgcccatgccgcagcagccattagcgtcacccgtgccggt
gcgcaaccgtctattccaaatcgtgcggaaacgttagatttcttggaaaaacaaggataa

DBGET integrated database retrieval system