KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0821Help
Entry
D11S_0821         CDS       T00993                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    D11S_0821 (recR)
DNA repair and recombination proteins [BR:aat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      D11S_0821 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
744525..745127
Genome map
AA seq 200 aa AA seqDB search
MQTSPLLENLIESLRVLPGVGPKSAQRMAYHLLQRNRSGGMRLAQGLTEAMSKIGHCEHC
RTFTEEDVCNICSNPRRQNSGLLCVVETPADILAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLQTESFNEVILATNPTVEGDATANYIAELCLQQNVKVSRIAHGIPVGGE
LEMVDGTTLTHSFLGRREIG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccttgttagaaaatctgatcgaaagtttacgcgtattgccgggcgtc
ggtccgaaatccgcgcaacgtatggcgtatcatttattgcaacgcaatcgcagcggcgga
atgcgcttggcgcaagggctgacggaagcgatgtcgaaaatcgggcattgtgaacattgc
cgcacttttacggaagaagatgtgtgcaacatttgtagtaatccacgccgtcaaaattcg
ggcttgctttgcgtggtggaaacgccggcggatattcttgctattgagcaaacagggcag
ttttccgggcgttatttcgtgctgatggggcatttgtcgccgctggacggtatcggcccg
cgcgaaatcggcttggatttgttgcaaaaacgcctgcaaacggaatctttcaatgaagtg
attttagccactaacccgacggtagaaggcgacgccacagcaaactacattgcggaactt
tgcctacaacaaaacgtcaaagtcagccgtattgcccacggcattccggtgggtggcgaa
ttggaaatggtggacggcaccacgctgacccattccttcttaggtcgccgtgaaatcggc
taa

DBGET integrated database retrieval system