KEGG   Arthrobacter aurescens: AAur_0905Help
Entry
AAur_0905         CDS       T00447                                 

Definition
ribonuclease
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
aau  Arthrobacter aurescens
Brite
Enzymes [BR:aau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     AAur_0905
Messenger RNA biogenesis [BR:aau03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     AAur_0905
Transfer RNA biogenesis [BR:aau03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    AAur_0905
 Prokaryotic Type
    AAur_0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951093..951566
Genome map
AA seq 157 aa AA seqDB search
MNRSRSKLVAFAGLVIAVVVLVVAMVGGGSLTAQTTTPEPGSTSTSPTAAATAGATPAVA
NPSSLPTINASQLPKEARQTLALIAKGGPYPYDRDGVNFGNFEGLLPKKSGGFYKEYTVP
TPGESDRGARRIIVGKDSAKYYTPDHYESFKFIVEDK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcagccgcagcaaactggtggcattcgcgggtctggtgatcgccgtcgtcgtg
ctggtggttgccatggtgggtggaggctcactgaccgcgcaaaccacgacgccggaacct
ggctccacatcgacgtcaccaacggcggcagccaccgcaggcgccactcccgccgttgcg
aacccctcttcgctgcccaccatcaatgcttctcagttacccaaggaagcgcgccagacc
cttgcgctgattgccaagggtggcccgtacccttatgaccgtgacggtgtgaacttcggc
aacttcgagggattgctgcctaagaagtccggtggtttctacaaggagtacaccgtgccc
acaccgggggagtcggaccgcggcgcgcgacgaatcatcgtgggcaaggactcggcgaag
tactacaccccggaccattacgagtcgttcaaattcattgtcgaagacaagtag

DBGET integrated database retrieval system