KEGG   Acidovorax citrulli: Aave_1729Help
Entry
Aave_1729         CDS       T00451                                 

Definition
putative endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
aav  Acidovorax citrulli
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1892605..1893114
Genome map
AA seq 169 aa AA seqDB search
MQAVAADPGTSPAVKIAMVMGSEYESSGRHIGTPYIDRAGRGQPLTVCNGVTGPEVDARR
YYSPADCYQLERARYIQAERDAARLLRHWPTYDAFAQATFIDFVWNKGPQALEGSTMRAK
ANRGDLEGACRENPRWNRGTVRGVSTVLPGLQLRGDSNDEICREWRLTP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggccgtggctgccgaccccggcacgtcgccggccgtgaagatcgccatggtcatg
ggatcggaatacgagtccagcgggcggcacatcggcacgccctacatcgaccgcgcaggc
cgcgggcagccgctgaccgtgtgcaacggcgtcaccggcccggaggtggacgcccggcgc
tactacagcccggccgactgctaccaactggagcgggcccggtacatccaggccgagcgc
gacgcggcgcggctgctgcggcactggcccacctacgacgctttcgctcaggccacgttc
atcgacttcgtgtggaacaaggggccgcaggcgctggagggcagcaccatgcgcgcgaag
gccaaccgtggcgacctcgagggcgcgtgccgggagaacccccgctggaaccgcggcacc
gtgcgcggcgtgtccacggtactgcccgggctgcagctccgcggcgacagcaacgacgaa
atctgccgtgaatggaggttgacaccatga

DBGET integrated database retrieval system