KEGG   Acinetobacter baumannii SDF: ABSDF0565Help
Entry
ABSDF0565         CDS       T00660                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
abm  Acinetobacter baumannii SDF
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:abm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABSDF0565 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABSDF0565 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABSDF0565 (trpB)
Enzymes [BR:abm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABSDF0565 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
519769..520980
Genome map
AA seq 403 aa AA seqDB search
MIDYTQFPDANGHFGIHGGRFVSETLMAALEDLENLYSRMKNDEQFLAEFDRDLAYYVGR
PSPLYYAERWSKELGGAQIYLKREDLNHTGSHKVNNTIGQALLAKLSGKKRIIAETGAGQ
HGVATATIAARLGLECVVYMGAEDVKRQAMNVYRMRLLGATVVPVQSGSKTLKDAMNEAM
RDWVTNVDTTYYVIGTVAGPHPYPQLVRDFQSIIGREARKQILEQAGRLPDALVACVGGG
SNAMGLFYPFLNDASVKMYGVEAAGFGIETGKHSAPLNAGHVGVLHGNRTYLMSDEQGQI
IETHSISAGLDYPGVGPEHSFLKDMKRVEYVPINDTGALQGFRDLTKIEGIIPALESSHA
MAYVSKLAPTMSKDQIIIATVSGRGDKDLMTVARIDGVEMVEM
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgattgactatacccaattcccagatgcaaatgggcatttcggtatccatggcggacgt
tttgtgtcagaaactttaatggcggcattagaagatttggaaaatctctattcccgcatg
aaaaatgatgaacagtttttggcagaattcgaccgtgacctcgcctactatgtaggtcgt
cctagtccactttattatgctgagcgatggtcaaaagagttaggtggtgcgcaaatttac
cttaaacgtgaagacttgaaccatacaggctcacacaaggtaaacaacacgattggtcag
gcactacttgcaaagctttctggtaaaaaacgtattattgccgaaactggtgcagggcag
catggtgtagcaacagcaacaattgcagcacgtttaggtcttgaatgtgttgtttatatg
ggtgctgaagacgttaagcgtcaagcgatgaacgtttaccgtatgcgtttgttgggtgca
acagttgtgcctgtgcaaagtggctctaaaacattaaaagatgccatgaacgaagcgatg
cgtgactgggtaaccaacgttgatacaacatattatgtgattggtacagttgcaggcccg
catccttatcctcaacttgttcgtgacttccagtcaattattggtcgtgaagcgcgtaaa
cagattttggaacaagcaggtcgcttaccagatgcattagttgcttgtgtaggtggtggt
tcaaatgcaatgggcttgttctatccgttcttaaacgatgccagtgtaaaaatgtatggt
gttgaagccgctggttttggtattgaaactggtaaacactctgcgccgttaaatgcgggt
catgtgggtgtattacatggtaaccgtacttatttaatgagtgatgaacagggccagatt
attgagacacacagtatctcggcgggccttgattatccgggtgttggtcctgaacatagc
ttcttgaaagatatgaagcgtgtagagtacgtgccgattaatgatacaggggctcttcaa
ggtttccgtgacttaaccaaaatcgaagggattattcctgcgcttgaaagctcgcacgcg
atggcgtatgtgtctaagcttgcaccgacgatgtctaaagatcagattattattgcgact
gtttcaggccgtggcgataaagacttaatgacagttgcacgcattgatggcgtagaaatg
gtcgagatgtaa

DBGET integrated database retrieval system