KEGG   Acinetobacter baumannii AB0057: AB57_1701Help
Entry
AB57_1701         CDS       T00793                                 

Definition
glutathione peroxidase (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AB57_1701
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AB57_1701
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AB57_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1794106..1794591
Genome map
AA seq 161 aa AA seqDB search
MSNIYQFEAELLEGDIKQFADYKGKVLLIVNTASKCGFTPQFAGLEKLYEKYKDQGLEVL
GFPCNQFGGQDPGSNKEIGTFCQRNYGVKFPMFAKVDVKGPEAHVIFRYLTREAKGILGS
STIKWNFTKFLVGKDGSVLNRYAPTTKPEALEADIEKALAS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacatttatcagtttgaagctgaattgttagagggagatattaaacaattcgct
gattacaaaggtaaagttttattaattgtaaatactgcaagtaaatgtggttttactcca
cagtttgcgggcctcgaaaaactttatgaaaagtataaagaccaaggtttagaagtttta
ggttttccctgcaatcagtttggtgggcaagatcccggaagcaataaagagataggtaca
ttctgccagcgtaactatggagtgaaattccctatgtttgccaaagtagatgtaaaaggt
cctgaagctcatgtgatctttagatatttaacccgtgaagcaaaaggaattttaggaagc
agtactattaaatggaactttaccaagtttttagttggtaaagatggttcggttttaaat
cgttatgcgccaacaaccaagcctgaagcattggaagctgatattgaaaaagcattagcg
agttaa

DBGET integrated database retrieval system