KEGG   Acinetobacter baumannii AB0057: AB57_3141Help
Entry
AB57_3141         CDS       T00793                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
abn  Acinetobacter baumannii AB0057
Pathway
abn00010  Glycolysis / Gluconeogenesis
abn00071  Fatty acid degradation
abn00350  Tyrosine metabolism
abn00625  Chloroalkane and chloroalkene degradation
abn00626  Naphthalene degradation
abn01100  Metabolic pathways
abn01110  Biosynthesis of secondary metabolites
abn01120  Microbial metabolism in diverse environments
abn01130  Biosynthesis of antibiotics
abn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:abn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB57_3141
  Lipid metabolism
   00071 Fatty acid degradation
    AB57_3141
  Amino acid metabolism
   00350 Tyrosine metabolism
    AB57_3141
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AB57_3141
   00626 Naphthalene degradation
    AB57_3141
Enzymes [BR:abn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AB57_3141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 Ufm1
Motif
Other DBs
NCBI-ProteinID: ACJ41725
Position
3269293..3270477
Genome map
AA seq 394 aa AA seqDB search
MAKPYYEFFCPVKVIAGNAALEHIPFELATLGAKCPLIITDKGVRANGLLNPIEAAFSTT
DAVIGHVFDDVPPDSSLEVVRLAAEAYRTNKCDAIIAVGGGSVIDTSKATNILVSEGGDD
LLQYSGAHNLPKPLKPFFVIPTTSGTGSEVTMVAVVSDTQKNVKLAFASYYLMPHAAILD
PRMTLTLPPHLTAMTGMDALTHCVEAYTCMAANPLSDAYASAGIKKISENLFNVLENPND
SQGRLELAQASTMAGIAFSNSMVGLVHSLGHALGAVAHLPHGLCMNLFLPYVLEYNKQVN
GKKIGELLLPLAGADIYAQTPATQRADRAIATILAMRDRLFSLTKLPRTLRETGKVTEAQ
LDEVAEKALNDGSIIYNPKEASLKDLREILQKAW
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccatattacgaattcttttgtcctgtaaaagtcattgccggtaatgctgct
ttagaacatatcccgtttgaacttgcgactttaggtgcaaaatgccctcttatcattacc
gataaaggtgttcgtgcaaatggcttgttaaaccctattgaagctgcttttagcacaact
gatgcagtcattggtcatgtttttgatgatgttccaccagactcaagccttgaagttgtt
cgacttgccgcggaagcttatcgcacaaataaatgtgatgcgattattgctgtgggtggt
ggttctgttatcgatacctctaaagcaactaacattttagtatcagaaggtggagatgat
cttcttcaatattctggtgcacacaacctaccaaaaccattaaaaccatttttcgtcatc
ccgactacatcaggtacgggatctgaagtgaccatggttgctgttgtgtctgatacacaa
aagaatgttaaattggcatttgcttcatattacttaatgccacatgctgcgattttagat
ccacgcatgacattaactttaccacctcacttaactgcaatgacgggtatggatgcgtta
acacattgtgttgaagcatacacctgtatggcagccaacccactcagcgatgcctatgca
agtgcaggtattaaaaagattagcgaaaatctatttaatgtcttagaaaatccaaatgac
tcacaaggtcgtttagaacttgcacaagcttctacaatggcaggtatcgcattctctaac
tcgatggtaggccttgtacactcattaggacatgcattaggtgcagttgctcacctgccc
cacgggctgtgcatgaacttattcttaccttatgtgcttgagtacaataaacaagtcaat
ggtaagaaaattggcgagttgctattaccacttgcaggtgccgatatttatgcccagact
cctgctactcagcgtgcagacagagcaatcgcaactattttagcaatgcgtgatcgttta
tttagcttaaccaaattaccacgtaccttacgtgaaacaggtaaagttactgaagcacag
cttgatgaagtggcagagaaagcactaaatgatggctcaattatttataatcctaaagaa
gcaagcttaaaagatctacgagagatcttacaaaaagcttggtaa

DBGET integrated database retrieval system