KEGG   Acinetobacter baumannii MDR-TJ: ABTJ_02846Help
Entry
ABTJ_02846        CDS       T02045                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
abr  Acinetobacter baumannii MDR-TJ
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:abr00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:abr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2917089..2918234
Genome map
AA seq 381 aa AA seqDB search
MKKLAILGVTVYSFAQLANAATLNVKPYGTTQDGQKVDLYTMSNNNGVSVSFISFGGVIT
QILTPDAQGKQNNIVLGFDDLKGYEVTDTKEGIHFGGLIGRYANRIGNAKFSLDGKTYNL
EKNNGPNSLHSGNPGFDKRVWQVKPLISKGETVKASLKLTSPNGDQGFPGKLDVEVIYSL
SDQNEFKIEYKAKTDQPTVVNLTNHSYFNLSGAGNNPYGVLDHVVQLNADRILVTDQNSL
PTGEIASVAGTPFDFRTPKAIVKDIRANNQQLAYGYGYDQTWVINQKSQGKLNLAAIVVD
PKSKRTMQVLTTEPSVQMYTANHLLGNIVGANGVLYRQADALALETQHFPDSPNQPAFPS
TRLNPNQTYNSVTVFKFGVQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagcaattttaggtgttacggtttatagctttgcacaactggcaaatgca
gcaacgttaaatgtaaaaccatatggtacgactcaagacggccaaaaagttgatctatac
accatgagtaataacaatggagtctcggtatcttttattagttttggtggtgtaattaca
caaatcttgactcccgatgcccaaggcaaacaaaataatattgttttgggctttgatgac
ctaaaaggctatgaagtcactgataccaaggaaggcattcattttggtggattaattggt
cgttatgcgaaccggattggtaatgctaaatttagcttagatgggaaaacgtataatctt
gaaaaaaataatggcccgaactcattacatagcggcaatcctggttttgataaacgtgtt
tggcaagttaaacccctcatttctaaaggtgaaactgttaaagcttctctgaagttaacc
agtccaaatggagatcaaggttttcctggaaaattagatgtagaagtgatttacagtctt
tcagatcaaaatgaattcaagattgaatataaagccaaaactgatcagcctacagtcgtc
aaccttaccaaccacagttatttcaacttatcaggcgctgggaacaatccttatggcgtg
ctagatcatgtggtacaactcaatgcagaccgtatattggtaactgatcaaaactcttta
ccaacaggtgaaattgcttcagttgcaggtacaccttttgattttcgaacgcctaaagca
atcgtaaaagatattcgagcaaataatcagcaattggcctatggatatggctatgaccaa
acttgggtaattaatcaaaagtctcaagggaaactcaatcttgcagctattgtggttgac
ccaaaatctaaacggaccatgcaagtcttaaccactgaaccaagtgtccaaatgtataca
gccaatcatttattaggaaatattgttggcgcaaatggcgtactctatcgacaagcagac
gcactagcattagaaacacagcattttccagacagcccgaatcaaccggctttcccgtct
acacgtttaaacccaaatcaaacttataacagtgttaccgtatttaagtttggtgttcaa
aaatag

DBGET integrated database retrieval system