KEGG   Acinetobacter baumannii ATCC 17978: A1S_1119Help
Entry
A1S_1119          CDS       T00486                                 

Definition
choline dehydrogenase-like flavoprotein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
acb  Acinetobacter baumannii ATCC 17978
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1309275..1310840)
Genome map
AA seq 521 aa AA seqDB search
MEMGRRWKAEDFAKNNWNTRRWIWRPGMKLFGYFNMRFFRHVTIICGNAVGGGSITYANT
LLVPPEHIWDEGTWADAADWKNEMPQHYAEAERMLGVTDNKIFGPADHMLKKMGEAVGVG
HTFKPTRVATFFPPEGEEGGKTYPDPYFNGEGPDRGTCTACGGCMTGCKHNAKNTLDKNY
LYFAEKNGAKVYEETKVVDVKPLNGKADGSDGYEVTTECSSSWFNKQRRTWRVRNVIFSA
SSLGTQEMLFRLKQSGSLPNISDDLGNRVRTNAESILGVRFFGKDVDMSKGVAIGSSIYI
DHDTHIEATRYQSGSDAMGLMCTYMAKGKPGWTRIFFWLWALICHPFIFLRMSNPVSFAR
QTLIFLVMQTADASINMRLKRNWFWPFGKVLSSEGKKLPVYIPQANAFTEKVAKIFNGHP
MTTITEILFNVPFTAHCMGGCAIASSPERGVVDGQNRVFNYKNLYVVDGSMLGANLGVNP
SLTITALAERAMSYIPAKHTLEEQAYTQTHNEVLEAAKVSA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggggcgacgctggaaagctgaagattttgctaaaaacaactggaatacccgc
cgctggatttggcgtccgggcatgaaacttttcggttatttcaacatgcgtttttttcgc
catgtcaccattatttgcggtaatgccgtaggtggcggttcaattacctatgccaatacc
ctactggttccacctgaacatatttgggatgaaggcacatgggcagatgccgcggactgg
aaaaatgaaatgcctcagcactatgctgaagcagaacgtatgcttggcgtgactgataat
aaaattttcggccctgccgaccacatgctaaagaaaatgggtgaagcagtcggtgttggc
catacatttaaacctactcgtgttgccactttctttccaccggaaggtgaagaaggtggc
aagacctaccccgacccttattttaacggcgaaggtccagaccgtggcacttgtaccgca
tgtggcggttgtatgacgggttgtaaacacaacgcaaaaaatacattagataaaaactat
ttgtactttgccgaaaaaaatggcgccaaggtttatgaagaaaccaaagtagttgatgtt
aaaccactcaatggtaaagccgatggcagcgatggttatgaagtcacgactgaatgttca
agctcatggtttaacaaacaacgtcgtacttggcgagttcgtaatgtaattttctctgca
tcttctttagggacacaagagatgttgttccgtttaaaacagtccggttctctgccaaat
atctctgatgatttaggtaatcgcgttcgtactaatgccgagtcgattttaggtgttcgc
ttttttggtaaagatgtcgacatgagtaaaggtgttgctattggttcaagtatttacatt
gaccatgacactcacattgaagcgactcgctaccaaagtggttcagatgccatgggcctt
atgtgtacttacatggctaaaggcaaaccgggttggacacgtattttcttttggttatgg
gcactcatttgccatccatttattttccttcgcatgagtaatcctgtcagttttgcacgt
caaaccttaattttccttgtcatgcaaactgccgatgcctcaatcaacatgcgcttgaaa
cgtaactggttctggccttttggcaaggtgttatcgagcgagggtaaaaagctacctgtt
tatattccgcaggccaatgcatttaccgaaaaagttgccaaaatatttaatggccacccc
atgacgaccattaccgaaattttgtttaacgtaccttttacagctcactgtatgggtggt
tgtgcaattgcttcaagtccagagcgtggtgtggtagatggacaaaatcgggtgtttaac
tataaaaacttatacgttgtagatggttcaatgttaggtgcaaatttgggggttaaccca
agtctcaccattacagctctagcagaacgtgcaatgtcttatattccggctaaacatact
ttagaagaacaagcttatactcaaactcataatgaagttttagaagcagcaaaagtatct
gcttaa

DBGET integrated database retrieval system