KEGG   Acinetobacter calcoaceticus: BDGL_002021Help
Entry
BDGL_002021       CDS       T01684                                 

Gene name
ruvA
Definition
holliday junction helicase subunit A
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
acc  Acinetobacter calcoaceticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:acc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BDGL_002021 (ruvA)
Enzymes [BR:acc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BDGL_002021 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2182057..2182656
Genome map
AA seq 199 aa AA seqDB search
MIGCLIGEVFALEAPTVLLNVNGVGYEIDTPLSTFCQLQKGQKVTLWTHLVVREDAQQLY
GFSDAQEKTIFRTLLKVNGVGPKMALGILSTLSVELLVHTIEHDDINTLVKVPGVGKKTA
ERLMIELRDRFKTLAQGTSTVATMPQIQFAANSPVAEAEAALQSLGYKPLEAQKAVAAVK
ADYTESADIIRAALKSMMK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatgtttaattggcgaagtgtttgccttagaagcccctactgtcttattgaat
gtaaacggtgtgggttatgaaattgatacgccactttcaacattttgccaattacaaaaa
ggccagaaagttacgttatggacgcatttggttgttcgtgaagatgctcaacaactctac
ggttttagtgatgctcaagagaaaacaattttccgcaccttattaaaagtaaacggtgtc
ggtcccaaaatggccttgggtattttatcgacgctaagtgttgagttattggttcacacc
attgaacatgatgatataaatacgctggtcaaagttccaggggttggcaaaaaaacagct
gaacgtttaatgattgaactccgtgaccgtttcaaaacattggctcaaggcacttcaact
gtggcgaccatgcctcaaattcaatttgctgcaaactctcctgttgcagaagcagaagct
gcgttgcaatctttaggttataagccacttgaagcacaaaaagctgttgctgcggttaaa
gccgattacacagaatcagccgatattattcgtgctgctcttaaatccatgatgaagtaa

DBGET integrated database retrieval system