KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1277Help
Entry
AciM339_1277      CDS       T02396                                 

Definition
(GenBank) peptidase family protein
  KO
K20608  tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
acf  Aciduliprofundum sp. MAR08-339
Brite
Enzymes [BR:acf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     AciM339_1277
Peptidases [BR:acf01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   AciM339_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M28 Peptidase_M20 Peptidase_M18 Nsp1
Motif
Other DBs
NCBI-ProteinID: AGB05139
UniProt: L0HPX5
Position
complement(1145668..1146663)
Genome map
AA seq 331 aa AA seqDB search
MLLEKLVKAFGVPGFEDEIRAIVKEHMEEYADEVHVDMLGNVIGVKHGGERKVMLAAHMD
QIGFMVSGITEDGYLVISPMGGVNPITLRSRIVRIRGKDGFVYGVIGEKPPHIEKKAEKK
EIKDLRVDIGVESRNEAEQLAPIGSVGSFVPNYLEMGNRIVATALDDRAGIYALLKTMEN
VESDATLYFVATVQEEVGLRGARISGFRLNPDIGIAIDVTHAKMPGIGSEEVPIVLGKGP
TIGVGPTAHPKLVHHFTHTELPFQIEPNPSRSGTDADIIQLSREGVATLVLSIPLRYMHS
SVEMIDKRDLENTVNIIKMALKDIGKVDLTL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgcttcttgaaaaacttgtaaaagcgtttggagtgcccggatttgaggatgaaatcaga
gccatcgtaaaagagcatatggaagaatatgcggacgaggtacatgtggacatgctaggc
aatgtgataggagtaaagcacggtggtgagaggaaggtcatgctcgcagcccacatggat
cagataggattcatggtcagtggaatcacagaagatggctatcttgtgatctctcccatg
ggtggcgtaaatcccataaccctccgttcgaggatcgtgagaatcagggggaaagatggc
tttgtgtacggtgtaataggtgagaagcctccgcatattgagaaaaaggccgagaaaaag
gagataaaggatcttcgcgtggacataggggttgagagcaggaatgaggcagagcaactt
gcaccaataggttccgttggaagttttgttccaaattacttggaaatggggaacaggatc
gtggccacagccctggacgatagggctggaatatacgcccttctcaaaacaatggagaat
gtggaaagtgatgccactctctattttgttgcaactgtccaggaagaggtgggactccgt
ggagcgaggatctcgggatttcggttaaatccagatataggcatagctatagatgtgacc
catgccaagatgccaggaattggaagtgaagaggtgccaatcgtgcttggaaagggtccc
acaataggtgtcggacccactgcccatccaaaactcgttcatcatttcacacacacagaa
ttaccattccaaatagagcccaatccatcaagaagcggtactgatgctgacataatacag
ctctcaagagagggtgtggcaactctcgttctttccataccgctcaggtacatgcactcc
agcgtggagatgatcgataagagagacctggaaaacacggtcaatataattaaaatggcc
ctaaaagatatagggaaggttgacctcacactatga

DBGET integrated database retrieval system