KEGG   Arthrobacter chlorophenolicus: Achl_2953Help
Entry
Achl_2953         CDS       T00834                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Achl_2953
   00052 Galactose metabolism
    Achl_2953
   00500 Starch and sucrose metabolism
    Achl_2953
   00520 Amino sugar and nucleotide sugar metabolism
    Achl_2953
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Achl_2953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3304449..3305339)
Genome map
AA seq 296 aa AA seqDB search
MTMGRAVTKAVIPAAGLGTRFLPATKAMPKEMLPVVDRPAIQYVVEEAIKSGLNDVLMIT
GRSKRALEDHFDRAPGLERLLEQKGDKDRLQSIQAASELGPIHYVRQGEAKGLGHAVLCG
KQHVGNEPFAVLLGDDLIDEAEDLLSTMIDVQQKTGGSVIALIEVDPSQISAYGCADISR
VEGEDYVRVNSLVEKPAAADAPSNLAVIGRYVLHPAVFGILENTAPGRGNEIQLTDALQT
LAAGEGEGSGVYGVVFKGRRFDTGDKLSYLKAVITIASERVEFGEDLKTWLKGFVN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgactatggggagagccgtaactaaagccgtcattcctgctgccggattgggaactcgc
ttcctgcccgccaccaaggcaatgccgaaggaaatgttgccggtggttgaccgcccggcc
atccagtacgtcgtcgaagaggccatcaaatccggccttaacgacgtcctgatgatcacg
ggccgcagcaagcgcgcccttgaggaccacttcgaccgtgcacccggcttggagcgcctg
ctggaacagaaaggtgacaaggaccggctgcagtccatccaggctgcgtccgagctcggt
cccatccactacgtccgccagggcgaagccaaagggcttggccatgcggtgctctgcggt
aagcagcacgtagggaacgagccctttgccgtgctgctcggtgacgacctcattgatgaa
gctgaagacctgctgagcaccatgatcgatgtccagcagaagaccggcggttcggtgatc
gccctaatcgaggtggatccgtcgcagatcagcgcctatggctgtgcggacatctctaga
gttgagggcgaagactacgtccgcgtcaacagcctggtggagaagccggctgctgccgac
gcgccctccaacctggccgtcattggccgctatgtcctgcacccggccgtattcggaatc
cttgagaacaccgcgccggggcgtggcaacgaaattcagctgactgatgcgctgcagacc
ctggccgctggcgaaggcgaaggctccggcgtgtatggcgtggtgttcaagggccgccgc
tttgataccggtgacaagctcagctacctgaaggccgttattaccattgcgtctgagcgg
gtggagttcggcgaggatctgaagacctggctcaagggtttcgttaactaa

DBGET integrated database retrieval system