KEGG   Acinetobacter sp. ADP1: ACIAD2335Help
Entry
ACIAD2335         CDS       T00185                                 

Gene name
glcB
Definition
(GenBank) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
aci  Acinetobacter sp. ADP1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACIAD2335 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACIAD2335 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ACIAD2335 (glcB)
Enzymes [BR:aci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ACIAD2335 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
complement(2298287..2300449)
Genome map
AA seq 720 aa AA seqDB search
MTARIQKGKLAIAKELYDFIENEALSASGLDSETYWKNFEQVVVDLSPKNKALLAKRDEL
QAKIDEWHRNNTFELEAYKAFLKEIGYLLPEVEDFQITTQNVDEEIALLAGPQLVVPVRN
ARYSLNAANARWGSLYDALYGFDVIPEDGGAEKGKGYNPVRGAKVIAFAKNFLDETFPLA
QGSHKNAVQYSVEQNALVITLDNGEKTSLAHEALFVGYNGEDSAPSEIVLKHNGLHVIIE
IDANSPIGKTDPASVKDLVLEAAITTIQDLEDSVAAVDAEEKVEGYRNWLGLMQGTLEES
IEKNGKTVTRKLSQDRTCKNLIGGTTTLHGRSLMLLRNVGHLMTNPAILVDGEEIYEGIM
DALVTSLLSIVDITGKNEVKNSRKGSMYIVKPKMHGPEEVAFTVELFERVEKALGLPEKS
LKVGIMDEERRTSVNLKNCIAQAKDRTIFINTGFMDRTGDEIHTFMEAGPFVCKGEIKGQ
KWFPAYENRNVMIGLQTGLRGKAQIGKGMWPKPDMLLDMYKTKIEHPEAGASCAWVPSPS
GAVIHAIHYHQCNVAERQQELLSTQALSLDDLLTPPLAADTNWSAEEITKELENNCQGIL
GYVVRWVDLGVGCSKVPDINDVGLMEDRATLRISSQHVANWLRHGIVSKEQVEEVLKRMA
KIVDEQNANDPAYTPMSPGFDGIAFQAASDLIFKGGEQPSGYTEPLLHAARLKLKGYTGD
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgactgcacgtattcaaaaaggcaagttagcgattgctaaagaactttacgattttatt
gagaatgaagctttatctgcttctggtttggacagtgaaacttactggaaaaactttgag
caagtcgttgtcgatcttagccctaaaaacaaggcactgcttgcgaagcgtgatgagtta
caggctaaaattgatgaatggcatcgtaacaatacatttgaattagaagcttacaaagct
ttccttaaagaaattggctacttattaccagaagtagaagattttcaaatcactacacaa
aatgtagatgaagaaattgcattacttgcagggccacaattggttgtacctgtacgcaat
gcacgttattcactgaatgcagcaaatgcacgttggggatcactctatgacgcattatac
ggcttcgatgttattccagaagatggtggtgctgaaaaaggcaagggatataatcctgta
cgtggtgccaaagttattgcatttgctaaaaactttttagatgaaacttttccattggct
caagggtcgcataaaaatgctgttcaatattcagttgaacaaaatgcactggttatcaca
ttagataatggtgaaaaaacctcattggcacatgaagcattatttgtcggttataacggc
gaagacagcgcaccttctgaaatcgtgcttaaacacaatggtcttcatgtcattattgaa
attgatgctaatagtccaattggcaagacagatccagcaagtgtaaaagacttagtactt
gaagctgcaatcacgacaattcaagatcttgaagattctgttgcagcggtagatgcagaa
gaaaaagttgaagggtatcgtaactggcttggattgatgcagggaactcttgaagagtcg
attgagaaaaatggtaaaaccgttactcgcaaactaagtcaggatcgtacctgtaaaaat
ctgattggtggaaccacgaccttgcacggtcgttcattgatgctactacgtaatgttggg
catttaatgactaatcctgcaattttagtcgacggtgaagaaatctacgaaggtattatg
gacgcgctggttacgtcattgctttcaattgtagatattactggcaaaaatgaagttaaa
aactctcgtaaaggttcgatgtatattgttaaaccaaaaatgcatggaccagaagaagta
gcatttactgtcgagttatttgaacgtgtagaaaaagcactgggcttaccagagaaatca
ctcaaagtcggcattatggatgaagagcgtcgtacttctgtcaatttgaaaaactgtatt
gctcaggcaaaagatcgcaccatctttattaatacaggatttatggatcgtacaggtgat
gaaattcatacctttatggaagctggtccatttgtgtgtaaaggtgagattaaaggtcaa
aaatggttcccagcttacgaaaatcgcaacgtaatgattggactgcaaacgggtttacgt
ggtaaagcgcaaattggtaaaggtatgtggcctaaacctgatatgttgcttgatatgtat
aaaaccaagattgaacatccagaagcgggtgcatcatgtgcatgggtaccatctccatct
ggtgctgtaattcacgcaattcattatcaccaatgcaatgttgcagagcgccagcaagaa
ttgctcagtacacaagcactgtcactagatgatctgttaacacctcctttggctgctgat
accaactggtctgctgaagaaattaccaaagagctggaaaataactgccaagggattttg
ggttacgtggtgcgttgggttgatctaggtgtgggttgttcaaaagtaccagatattaat
gatgtcggactcatggaagaccgtgcgacactgcgtatttcttctcagcatgtagcaaac
tggttacgtcacggtatcgtaagcaaagagcaggttgaggaagtgctaaaacgtatggcc
aaaattgttgatgagcaaaatgccaatgatccagcatataccccgatgtctcctggtttt
gatgggattgcgtttcaggcagcatctgatctcatctttaagggcggtgaacaaccatcg
ggttatactgagccattattacatgcggcacgtttgaagttaaaaggatatacgggagac
taa

DBGET integrated database retrieval system