KEGG   Acidovorax sp. KKS102: C380_08345Help
Entry
C380_08345        CDS       T02290                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ack  Acidovorax sp. KKS102
Brite
Enzymes [BR:ack01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     C380_08345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1824428..1825210
Genome map
AA seq 260 aa AA seqDB search
MQRRPGFPAKLPVPGNAAAGKPVVAPPSVALRKPAVAPAPAGVGLDSSAVRARMVQKLAA
GGITLPPVLQAMGAVERHRFVDSALVNQAYEDTSLPIGLGQTISKPSVVARMCELLLGAE
SARHGGLGRVLEIGTGCGYQAAVLSLLAREVYTLERLRGLHDKARDNLRPFRLANVHLLF
GDGMLGYAKGAPYAAIIAAAGGDAVPMAWCDQLAVGGRLVAPMALSGGQQMLLVIDRTPH
GLKQNVLEPVHFVPLKSGIE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgcccggggttcccggccaagctgccggtgccgggcaacgccgctgcgggc
aagccggtggtggcgcccccgtccgtggccctgcgcaaaccggccgtcgccccggcgccc
gccggggtagggctggactcgtcggctgtccgtgcccgcatggtgcaaaaactggcggcg
ggcggcatcacgttgccccccgtgctgcaggccatgggcgctgtagagcgtcaccggttt
gtggacagtgcactggtcaaccaggcctatgaggacaccagcctgccgataggcttgggc
cagaccatctccaagcccagcgtggtggcgcgcatgtgcgagctgctgctgggggccgag
agtgcacgccatggcgggctgggccgtgtgctggagattggcacgggctgcggctaccag
gcggccgtgctgagcctgctggcccgcgaggtgtacacgctggagcgcctgcgcggcctg
cacgacaaggcgcgcgacaacctgcggccgttccgcctggccaacgtgcacctgctgttt
ggcgacggcatgcttggctatgccaaaggtgctccgtacgcggccatcatcgcggcggcc
ggcggcgatgccgtgcccatggcgtggtgcgaccagctggccgtggggggccgtctggta
gcgcccatggcgctgtcgggtgggcagcagatgttgctggtgatcgacagaaccccgcac
ggattgaaacaaaacgtgctcgagcccgtgcattttgtccccctaaaatcggggattgag
taa

DBGET integrated database retrieval system