KEGG   Acholeplasma laidlawii: ACL_0726Help
Entry
ACL_0726          CDS       T00659                                 

Definition
glycosyl hydrolase family 30 protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
acl  Acholeplasma laidlawii
Pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ACL_0726
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ACL_0726
Enzymes [BR:acl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ACL_0726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(767939..769420)
Genome map
AA seq 493 aa AA seqDB search
MLKLQASTQIHKRIFLLCLVCICLMMLIACDNTNNGEPPIVKKTYSVDSFTTWADKSKLL
KKEEASNTTIDLDSEYTKINIDPSIKYQVIDGFGAAMTESSALVINNLDENDKHNVLDEL
FNKEGLNMSFMRLTIGASDFSLDNYTYNDTPSNIEDLALNNFSIDREMQHLIPVLKEALI
RNNDLFIMASPWSAPAWMKDNKHLNGGSLLDKYIDVYAQYFVKYIEAMKLQGIDIYAVTP
QNEPLHESNTYPTMKMLPDQQINLIESMGIQFNEANIDTLIMAYDHNWDRMDYPITVLNS
KANQYIAGVALHGYGGNVSETSRLGNIFPDKGIWFTEISGGLWATNFGDNISWNMENIFM
GSLNRGAKGVLMWNIALNENNGPINGGCQNCRGILTIHSETSEVIKNEEYYMIGHFSKFV
EVGAYRIDSKTSNANLLNTAFLNPDGSITVVVHNKSSNSMMFSLDINGSQMNYKLPAKAT
TTFVLNENISNEN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagttacaagctagcacacagatacataagcgtatcttcttgttatgcttagtg
tgtatatgtttaatgatgcttattgcatgtgataatacgaataatggagaaccccctatc
gtgaaaaaaacttattcagtggatagctttacaacatgggctgataaaagcaaattactt
aaaaaagaagaggcttcaaataccactatagatttagattcagagtacacaaaaatcaat
attgatcctagtataaaataccaagtaattgatggttttggagcagcgatgacagaatct
agtgctttagtcattaataatttggatgaaaatgataaacataatgtattagatgaacta
tttaacaaagaagggttaaatatgtcatttatgcgacttactataggtgcatctgacttt
tccttagacaattatacgtataatgatacgccaagtaacatagaagacttagcattaaat
aacttttctatcgatagagagatgcaacatcttataccagttttaaaagaagcactcata
agaaataacgacctatttattatggcatctccatggagtgcaccagcttggatgaaagat
aataaacaccttaatggtggtagtttactggataagtacatcgatgtctatgcacaatat
tttgttaaatatattgaagctatgaagcttcaaggcatcgatatatatgcagttacaccg
caaaatgaaccacttcatgaatcaaacacttatcctacaatgaaaatgttgccagatcaa
caaataaatttaattgagtctatgggcatccaatttaatgaagccaatatcgatacatta
atcatggcatatgaccataattgggatcgaatggactacccaataactgtactaaatagt
aaagcaaatcaatatattgcaggggttgcattacatggttatggtggaaatgtatcagaa
acttcaagattaggtaacatatttcctgataaaggtatttggttcacagaaatatccggt
ggtttatgggctacgaattttggagacaatatatcgtggaatatggaaaatatttttatg
ggttctctaaatcgcggcgctaaaggtgtattgatgtggaacattgccttaaatgaaaac
aatggacctatcaatggtgggtgccaaaattgccgtggcattttaactattcatagtgaa
acttcagaggttattaaaaatgaagaatactatatgatcggacatttttctaaatttgta
gaggttggagcatatagaatagatagtaaaacaagtaatgcaaatttactaaacacagca
tttttaaaccctgatggtagtattacagtcgtggtacataataaatcttctaattcaatg
atgtttagtttagatataaatggtagccaaatgaattataaactaccagcaaaagcaact
acaacatttgttttaaacgaaaatattagtaacgaaaattaa

DBGET integrated database retrieval system