KEGG   Anolis carolinensis (green anole): 100564214Help
Entry
100564214         CDS       T01608                                 

Definition
OTU domain-containing protein 5-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:acs04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 384 aa AA seqDB search
MSVTESLNIYAVAEGYSSAWEHRFEKALREKKGFIIKQMKEDGACLFRAVADQVYGDQDM
HEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVY
QYGTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPSFKPGYAEQSL
MKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQPRKA
SATCSSATAAAASGLEEWSGRSPRQRSSASSPEHPDLHNELNAAKPPSPGSTAALALTKP
PSPCAPGTSSQLSAGSGRATPPLVSLYPALECRAIMQQMSPTAFGLSDWDDDEILASVLA
VSQQEYLESMKKSTLHRDSGSDKS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcacagagagccttaacatctatgcagtggcggaaggctacagcagtgcatgg
gaacacaggttcgagaaagctctgagggagaagaaagggttcatcataaaacaaatgaag
gaagatggagcctgcttgttccgggctgtagctgaccaagtatacggtgaccaggacatg
catgaagtggtccggaagcattgtatggattacctgatgaagaatgccgattacttctcc
aattatgtgaccgaagatttcaccacttacatcaaccggaagcggaaaaacaactgccat
ggcaaccacattgagatgcaggctatggcggagatgtacaatcgacctgtggaggtttac
cagtatggcacagagcccattaacacttttcacggcattcatcagaacgaggatgaaccc
atccgagtgagctatcaccgcaacatccattacaactcggtggtgaaccccaacaaagct
acaattggtgtggggctgggattgccctccttcaaaccagggtatgcagaacagtccttg
atgaagaatgcaatcaagacgtcagaagagtcatggattgagcagcagatgctggaagat
aagaaacgggcaacagactgggaagcaaccaacgaagccattgaagagcaggttgccagg
gagtcctatttacagtggctacgtgatcaggaaaagcaggccagacagccccgaaaagcc
agtgctacttgtagctctgccacggcggccgcagccagcggtttggaagaatggagtggc
cgctctccgcgtcagcgcagttcagcgtcttccccagagcaccccgacctgcacaatgag
ctgaatgctgccaaaccgccttcccctggaagcacagcagctcttgcacttaccaaaccc
ccctcgccatgtgctcctggaacaagcagccagctttctgcaggcagtggccgagcaacc
cctcccttagtgtcattgtatccagccctggaatgccgggcaataatgcaacagatgtca
cccacagcgttcggcttgagtgactgggatgatgacgagatcctggcttctgtgctggct
gtgtcacaacaggagtacttggaaagcatgaagaagagcaccctgcacagagacagtggc
tccgacaagagttga

DBGET integrated database retrieval system