KEGG   Anolis carolinensis (green anole): 100564214Help
Entry
100564214         CDS       T01608                                 

Gene name
otud5
Definition
(RefSeq) OTU deubiquitinase 5
  KO
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100564214 (otud5)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100564214 (otud5)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   100564214 (otud5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 346 aa AA seqDB search
MKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNN
CHGNHIEMQAMAEMYNRPVEVYQYGTEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
KATIGVGLGLPSFKPGYAEQSLMKNAIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQV
ARESYLQWLRDQEKQARQPRKASATCSSATAAAASGLEEWSGRSPRQRSSASSPEHPDLH
NELNAAKPPSPGSTAALALTKPPSPCAPGTSSQLSAGSGRATPPLVSLYPALECRAIMQQ
MSPTAFGLSDWDDDEILASVLAVSQQEYLESMKKSTLHRDSGSDKS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagatggagcctgcttgttccgggctgtagctgaccaagtatacggtgaccag
gacatgcatgaagtggtccggaagcattgtatggattacctgatgaagaatgccgattac
ttctccaattatgtgaccgaagatttcaccacttacatcaaccggaagcggaaaaacaac
tgccatggcaaccacattgagatgcaggctatggcggagatgtacaatcgacctgtggag
gtttaccagtatggcacagagcccattaacacttttcacggcattcatcagaacgaggat
gaacccatccgagtgagctatcaccgcaacatccattacaactcggtggtgaaccccaac
aaagctacaattggtgtggggctgggattgccctccttcaaaccagggtatgcagaacag
tccttgatgaagaatgcaatcaagacgtcagaagagtcatggattgagcagcagatgctg
gaagataagaaacgggcaacagactgggaagcaaccaacgaagccattgaagagcaggtt
gccagggagtcctatttacagtggctacgtgatcaggaaaagcaggccagacagccccga
aaagccagtgctacttgtagctctgccacggcggccgcagccagcggtttggaagaatgg
agtggccgctctccgcgtcagcgcagttcagcgtcttccccagagcaccccgacctgcac
aatgagctgaatgctgccaaaccgccttcccctggaagcacagcagctcttgcacttacc
aaacccccctcgccatgtgctcctggaacaagcagccagctttctgcaggcagtggccga
gcaacccctcccttagtgtcattgtatccagccctggaatgccgggcaataatgcaacag
atgtcacccacagcgttcggcttgagtgactgggatgatgacgagatcctggcttctgtg
ctggctgtgtcacaacaggagtacttggaaagcatgaagaagagcaccctgcacagagac
agtggctccgacaagagttga

DBGET integrated database retrieval system