KEGG   Anabaena cylindrica: Anacy_2597Help
Entry
Anacy_2597        CDS       T02435                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
acy  Anabaena cylindrica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acy01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:acy00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2961678..2963003
Genome map
AA seq 441 aa AA seqDB search
MLRIITQQADVRAELQRICERLQRAEGERTQDEQLLHKEATVREILQAVKRQGDKAVLHY
TSEFDHQTLQPEELRVTGSELDAAYQQVSKDLLAAIQLACRQIEEFHRQRVPKSWVHFGE
DEIVLGKRYTPVDRAGLYVPGGRASYPSTVLMNAIPAKVAGVPRVVMVTPTRGEKTISSA
VLVAAQEAGVQEIYRIGGAQAIAALAYGTETIPKVNVITGPGNIYVTLAKKLVYGTVGID
SLAGPSEVLIIADETANPAHVAADMLAQAEHDPMAAAILLTTDAGLAKKVQVAVERQLID
HPRRIDTEKAIAHYGLIVVVESLTAAAELSNEFAPEHLELEIKDPWALISQIRHAGAIFL
GYSTPEAVGDYLAGPNHTLPTSGAARYASALGVETFLKHSSIIQYSPTALHKVAGAIDAL
ANAEGLPSHADSVRRRVEENE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattattactcagcaggcagacgttagagccgaactacaacgtatctgcgaa
cgtctccaacgcgccgaaggcgaacgcacccaggatgaacaattgcttcacaaagaagca
acagtgagggaaattttgcaagcagtcaagcgccaaggcgataaagctgtattgcattat
acttcagaatttgaccaccaaaccttgcagccagaagaactaagggtgacaggttcagaa
ctggatgcagcttaccaacaggtatcaaaggatttgttggcagctattcaactggcttgt
cgccaaattgaagagtttcaccgacagcgagtaccaaaaagctgggtacactttggcgag
gatgaaatagtacttggtaaacgctatacccctgtagatcgggcaggtttatacgttcca
ggtggtcgcgcctcctatcccagtacggtgctgatgaatgctattccagccaaagtggca
ggtgtcccccgtgtagtgatggtaacaccaacacgaggagaaaaaacgattagttccgca
gttttagtagctgcacaagaggcgggggtacaagaaatttatcgcattgggggcgctcaa
gcgatcgcagctttagcttacggtacagaaacgattccgaaagtgaatgtgattactgga
ccaggcaacatctatgtcaccttagccaaaaaattagtttatggaacagtgggtattgat
tcattagcaggccccagcgaagtgctgattattgctgatgaaacagctaatcctgcacac
gttgcggcggatatgttagcccaagcggaacatgatccaatggcggcggcaattctgtta
acaacagatgctggtttagcaaaaaaagtccaagtagctgtagaacgacaattaatagat
cacccacgacggatagacacagaaaaagcgatcgctcattacggcttaattgtcgttgtc
gaatctctcaccgcagcagcagaactctcaaatgaatttgctcctgaacacctggaatta
gaaattaaagatccctgggctttgatttctcagattcgccatgctggggctattttcctg
ggttattcaacaccagaagctgtaggtgactatttagcggggccaaaccataccttacca
acctccggtgcagcccgttatgcttctgccttaggtgtagaaacttttctcaaacactct
agtattattcaatactcaccaactgcactacacaaagtagctggtgcaattgacgcacta
gcaaacgctgaaggtttaccttcccacgctgattcagtacgacggcgagttgaggaaaat
gagtaa

DBGET integrated database retrieval system