KEGG   Anabaena cylindrica: Anacy_2597Help
Entry
Anacy_2597        CDS       T02435                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
acy  Anabaena cylindrica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Anacy_2597
  Amino acid metabolism
   00340 Histidine metabolism
    Anacy_2597
Enzymes [BR:acy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Anacy_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2961678..2963003
Genome map
AA seq 441 aa AA seqDB search
MLRIITQQADVRAELQRICERLQRAEGERTQDEQLLHKEATVREILQAVKRQGDKAVLHY
TSEFDHQTLQPEELRVTGSELDAAYQQVSKDLLAAIQLACRQIEEFHRQRVPKSWVHFGE
DEIVLGKRYTPVDRAGLYVPGGRASYPSTVLMNAIPAKVAGVPRVVMVTPTRGEKTISSA
VLVAAQEAGVQEIYRIGGAQAIAALAYGTETIPKVNVITGPGNIYVTLAKKLVYGTVGID
SLAGPSEVLIIADETANPAHVAADMLAQAEHDPMAAAILLTTDAGLAKKVQVAVERQLID
HPRRIDTEKAIAHYGLIVVVESLTAAAELSNEFAPEHLELEIKDPWALISQIRHAGAIFL
GYSTPEAVGDYLAGPNHTLPTSGAARYASALGVETFLKHSSIIQYSPTALHKVAGAIDAL
ANAEGLPSHADSVRRRVEENE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattattactcagcaggcagacgttagagccgaactacaacgtatctgcgaa
cgtctccaacgcgccgaaggcgaacgcacccaggatgaacaattgcttcacaaagaagca
acagtgagggaaattttgcaagcagtcaagcgccaaggcgataaagctgtattgcattat
acttcagaatttgaccaccaaaccttgcagccagaagaactaagggtgacaggttcagaa
ctggatgcagcttaccaacaggtatcaaaggatttgttggcagctattcaactggcttgt
cgccaaattgaagagtttcaccgacagcgagtaccaaaaagctgggtacactttggcgag
gatgaaatagtacttggtaaacgctatacccctgtagatcgggcaggtttatacgttcca
ggtggtcgcgcctcctatcccagtacggtgctgatgaatgctattccagccaaagtggca
ggtgtcccccgtgtagtgatggtaacaccaacacgaggagaaaaaacgattagttccgca
gttttagtagctgcacaagaggcgggggtacaagaaatttatcgcattgggggcgctcaa
gcgatcgcagctttagcttacggtacagaaacgattccgaaagtgaatgtgattactgga
ccaggcaacatctatgtcaccttagccaaaaaattagtttatggaacagtgggtattgat
tcattagcaggccccagcgaagtgctgattattgctgatgaaacagctaatcctgcacac
gttgcggcggatatgttagcccaagcggaacatgatccaatggcggcggcaattctgtta
acaacagatgctggtttagcaaaaaaagtccaagtagctgtagaacgacaattaatagat
cacccacgacggatagacacagaaaaagcgatcgctcattacggcttaattgtcgttgtc
gaatctctcaccgcagcagcagaactctcaaatgaatttgctcctgaacacctggaatta
gaaattaaagatccctgggctttgatttctcagattcgccatgctggggctattttcctg
ggttattcaacaccagaagctgtaggtgactatttagcggggccaaaccataccttacca
acctccggtgcagcccgttatgcttctgccttaggtgtagaaacttttctcaaacactct
agtattattcaatactcaccaactgcactacacaaagtagctggtgcaattgacgcacta
gcaaacgctgaaggtttaccttcccacgctgattcagtacgacggcgagttgaggaaaat
gagtaa

DBGET integrated database retrieval system