KEGG   Asticcacaulis excentricus: Astex_0235Help
Entry
Astex_0235        CDS       T01378                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aex  Asticcacaulis excentricus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aex00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Astex_0235
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Astex_0235
   00640 Propanoate metabolism
    Astex_0235
   00660 C5-Branched dibasic acid metabolism
    Astex_0235
Enzymes [BR:aex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Astex_0235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:250872..252149
Genome map
AA seq 425 aa AA seqDB search
MRRTACISSLVPLTRAGIPFDKTGSMNIHEHQAKAVLKEFGVAVPRGYPAFSPKEALEAA
KNLKDDSTKVWVVKSQIHAGGRGKGRFEGLGPDAKGGVRVVKSPADVEANADEMLGRVLV
THQTGPAGKQVNRLYIEEGADIKKELYLSLLVDRVSSRISVVASTEGGMDIEEVAHSTPE
KIHSFTIDPATGVFPVHGRTLAHALGLKGDLAKQGFKLLQQLYAAFNAKDMDMLEINPLI
ITGDDQLLVLDAKVSFDSNSLFRHPDIQALRDLSEEDAKEIEASKFDLSYIALDGEIGCM
VNGAGLAMATLDIIKLYGSEPANFLDVGGGATTEKVTAAFKIITSDPKVKGILVNIFGGI
MKCDIIATGVIAAVKEVGLKVPLVVRLEGTNVELGKKIINESGLNVIAADDLADAAAKIV
KAVKG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcacggcttgtatttcctcgctggtaccgctaacacgggccggcatcccattt
gataagaccggttccatgaacattcacgagcatcaagccaaggccgtactcaaggagttc
ggcgtcgccgttccgcgcggctatcccgccttttcgcccaaggaagcccttgaggccgcc
aagaacctgaaggacgattccaccaaggtgtgggtcgttaagtcgcaaatccacgccggt
ggccgtggtaaaggccgtttcgaaggcctggggccggacgccaagggcggcgtgcgcgtc
gtcaagtcgccggctgacgtcgaagccaatgccgacgaaatgctgggccgcgtgctcgtg
acccatcaaacgggtccggcgggcaagcaggtcaatcgcctgtacatcgaagaaggtgcg
gacatcaaaaaggagctgtatctgtcgctcctcgttgaccgcgtctcgtcacgtatctcg
gtcgtcgcctcgaccgaaggcggtatggacatcgaagaagtcgcccattcgactccggaa
aagatccactccttcaccatcgatccggccaccggtgtcttccccgtgcacggccgtact
ctggcgcatgctctgggtctgaagggtgatctggccaagcagggcttcaagctgcttcag
caactgtatgcggcgttcaatgccaaagacatggacatgctggaaatcaacccgctgatc
atcacgggcgacgaccagcttctggtgctcgacgccaaggtgtcgttcgattccaactcg
ctgttccgtcatccggatattcaggccctgcgcgacctgagcgaagaagacgccaaggaa
attgaagcctcgaagttcgacctctcctatatcgcccttgacggcgaaatcggctgcatg
gtcaacggcgcgggtctggccatggccacgctcgacatcatcaagctctatggttcagag
cccgccaacttcctcgacgttggcggcggcgcgaccactgaaaaggtgacggcggccttc
aagatcatcacctcggaccccaaggtgaagggcattctggtcaacatcttcggtggcatc
atgaagtgcgacatcatcgccacgggcgttatcgccgcggtgaaggaagtcggcctgaag
gtgcctctggtggtgcgcctcgaaggcaccaatgtcgaactcggcaagaaaatcatcaac
gaaagcggcctgaacgtgatcgccgccgacgatctggccgatgcggccgccaagatcgtc
aaggctgtgaagggctaa

DBGET integrated database retrieval system