KEGG   Alistipes finegoldii: Alfi_0150Help
Entry
Alfi_0150         CDS       T02133                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
afd  Alistipes finegoldii
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:afd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Alfi_0150
Enzymes [BR:afd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Alfi_0150
Transfer RNA biogenesis [BR:afd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Alfi_0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(175206..176051)
Genome map
AA seq 281 aa AA seqDB search
MINDKVRMYLLPPLFNAAVRAGASIMNIYKNLDDYDISLKDDKTPITLADRLAHKTIREY
LGRTRIPILSEEGREMRYDERRNWELYWLVDPLDGTVEFIKGNNEFTVNIALMENNVCMG
AVIYVPYFEKMYVAGRDSGSYVKEHIAPDAAAEYTYDQIVTGWRQLPLEEGAEHPRLRVA
VSRSHQTPETAEHIARLREAHPDLEIVEQGSSYKFCLLAEGKVDYYVRTTHTYEWDTAAG
ELILAEAGGRTRTLPDDRELLYNEEDLRNPWFVCRSKHCKI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgataaacgacaaggtgaggatgtatctgctgccgccgctgttcaatgcggcagtcagg
gccggagcctcgataatgaatatttacaagaatttagacgattacgatataagcctcaaa
gacgacaagacgccgatcaccctcgccgaccgcctagcacacaaaaccatccgcgaatat
ctgggccgcacgcgcatcccgatcctgagtgaggagggccgcgagatgcgctacgacgaa
cgccgcaactgggagttgtactggctggtcgatccgctcgacggaacggtcgagttcatc
aagggaaacaacgaatttaccgtgaatatcgccctgatggagaacaacgtctgcatgggg
gcggtcatttatgtcccctatttcgaaaagatgtacgtcgccgggcgggattcgggttcc
tacgtcaaggagcatattgcgccggatgccgccgccgaatacacttacgaccagatcgtc
acgggctggcggcagctgccgctcgaagagggggcggagcacccccgcctgcgggtggcc
gtgtcgcggtcgcaccagacgcccgaaacggcggagcatatcgcccgcctgcgcgaagcg
catcccgatctggagatcgtcgagcaggggagttcctacaaattctgcctgctggccgag
gggaaggtcgattattatgtccgcacgacgcatacgtacgagtgggacactgccgcgggc
gagctgatcctcgccgaagcgggcggccgcacccgcacgctgcccgacgaccgggaactg
ctctacaacgaggaggacctgcgcaatccgtggttcgtctgccggtcgaaacactgcaag
atttga

DBGET integrated database retrieval system