KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2462Help
Entry
Lferr_2462        CDS       T00758                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Lferr_2462
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lferr_2462
   00052 Galactose metabolism
    Lferr_2462
   00500 Starch and sucrose metabolism
    Lferr_2462
   00520 Amino sugar and nucleotide sugar metabolism
    Lferr_2462
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Lferr_2462
   00524 Butirosin and neomycin biosynthesis
    Lferr_2462
Enzymes [BR:afe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Lferr_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2427803..2428750
Genome map
AA seq 315 aa AA seqDB search
MTEGLTIGIDVGGTNLRFGVFRGNELLDSTRSEVDLREKCRQAPDPEGAAALVTTLLTEG
IADLRRHHPNIARVGIAFPGFIDDDGVLLQSPNIPQLIQFDLQTAVGAACQLPVLVENDA
NAAGYGEFWEERQEHPELQNLLYVGLGTGVGGGWIHQGRPWRGDHGSAMEIGHIIVVPGG
RRCGCGNQGCLEQYASARGVQSTYVELTGTAPDAMVIAQMAGDAHSEAASAFRMAGGYLG
QVLAHVVKVTDVAVVRIGGGMSAAWDRFAPAMLQRLDADMIPALRGNVEVKRGNDDDLAG
MRGAALLADQEFLHS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgactgagggcctgaccatcggcatcgatgtgggcggcaccaacctgcgtttcggcgtc
tttcgcggtaacgaacttctggactccacccgcagtgaagtggatttgcgcgagaagtgc
cgccaggcaccggacccggagggtgcagcggcgctggtcaccaccctcctgaccgaaggc
atcgccgacctgcgtcgccatcatcccaatatcgcgcgagtcggtattgctttcccgggc
tttatcgatgatgacggcgtattgctgcaatcccccaacattccgcaattgattcagttc
gatctgcaaaccgccgtcggcgcggcctgccaactccccgtcctcgtcgaaaacgacgcc
aacgctgcgggctatggtgaattctgggaggagaggcaggagcacccggaactgcaaaat
ctgctctacgtcggcctcggcacgggagtcggcggcggctggattcatcagggccgacct
tggcggggggaccacggcagcgccatggaaatcggtcatatcatcgtggtgcccggaggg
cggcgttgtggttgtggcaatcagggctgcctggaacagtacgcctcggcgcgcggggtg
caatccacctacgtggagctgaccggcacggccccggacgccatggtcattgcccagatg
gccggcgatgcccacagtgaagccgccagcgcctttcggatggctggtggctatctggga
caggtgctggcccacgtcgtcaaggtaaccgatgtcgcggtggtgcggattggcggcggc
atgagcgccgcatgggaccgcttcgccccggccatgctgcaacgcctcgacgcggatatg
attcccgcgttgcgcggtaacgtcgaagtgaaacgcggcaatgacgacgacctcgccggc
atgcgcggggccgcgctactcgccgatcaagagtttctccatagctga

DBGET integrated database retrieval system