KEGG   Acidithiobacillus ferrooxidans ATCC 53993: Lferr_2650Help
Entry
Lferr_2650        CDS       T00758                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
afe  Acidithiobacillus ferrooxidans ATCC 53993
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Lferr_2650
  Amino acid metabolism
   00340 Histidine metabolism
    Lferr_2650
Enzymes [BR:afe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Lferr_2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2631396..2632697
Genome map
AA seq 433 aa AA seqDB search
MNRLDTSDPDFAQQFHALHDWDANLDPQIEVRVREIVTTVRDRGDAALREYTERFDGVTT
ASAAELEIPRSAWDAALHGLEPTQRVALEEAAQRIRSYHEHQRSVGWTFTEADGTMLGQR
ILPLARVGIYVPGGKAAYPSSVLMNAIPAHVAGVKEIIMTVPTPQGQVNPWVLAAAAIAG
VDRVFCIGGAQAVAALAYGTESVPAVDKIVGPGNIYVATAKRMVFGRVGIDMIAGPSEIL
VISDGSAPAEWLAWDLLSQAEHDEIAQSIFISWDDAHIESVVNAVDAALDVLDRAPIARK
SWADRGAVIRVRDRAEACAIADRIAPEHLELAVQNPEDWLADIHNAGAIFMGIHSCEALG
DYVAGPNHVLPTGGSARFSSPLGVYDFVKRSSLIHSSPAGAARLGQIAERLALGEGLTAH
ARSAACRIPEAGS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtctggacaccagcgaccctgatttcgcccagcagtttcacgcgctgcatgat
tgggatgccaacctcgatccgcagatcgaagtgcgggtacgagagatcgtcaccaccgtc
cgtgatcggggcgatgcggcgctacgcgagtacacggagcgctttgatggggtgacgacg
gcttccgccgctgagctggagatcccccgcagtgcctgggatgcggcgctccacggtctg
gagcccacccagcgagttgccctggaagaggcggcgcaacgtatccgcagttaccacgag
caccagcgcagtgtaggctggacctttaccgaggccgacggcacgatgctcggacagcgc
atcctgcccttggcccgggtggggatttacgtacccggcggcaaggcggcttatcccagc
tccgtgctgatgaatgccattcccgcgcacgtggcgggcgtgaaggaaatcatcatgacc
gtacccaccccgcaggggcaggtgaatccctgggtgctggccgcagccgccattgccggg
gtggaccgggtgttctgtatcggcggtgcgcaggcagtggcggcgctcgcctacggtacg
gagagcgtccccgcggtagacaagattgtcggccccggcaatatctatgtggctaccgcc
aagcgcatggtctttggccgggtaggcatcgatatgattgccggacccagcgaaatcctc
gtgatcagcgatggctcggcaccggcggaatggttggcctgggacctgctctcacaggcg
gagcatgatgagattgcccagagtattttcatcagttgggacgatgcccacatcgagtcg
gtggtgaacgcggtggatgccgccctcgatgtgctcgatcgcgcacccatcgcccgcaag
agctgggcagaccggggggcggtgattcgtgtgcgggaccgtgccgaggcctgcgccatt
gccgaccgtatcgcgccggaacatctggaactagcggtgcagaatcccgaagactggctg
gcggacattcacaatgccggggccatcttcatgggcatccatagttgtgaggccctcggc
gactatgtggccggccccaaccatgtgctgcccacggggggcagcgcacgtttttcctcg
cccctcggcgtctatgatttcgtcaagcggagcagcctcattcacagcagccccgccggc
gccgcgcgactgggacagatcgccgaacgtctcgccctgggcgagggcctgaccgcccat
gcccgttcagcagcctgccgcatccccgaagccggatcatga

DBGET integrated database retrieval system