KEGG   Anoxybacillus flavithermus: Aflv_0527Help
Entry
Aflv_0527         CDS       T00790                                 

Definition
(GenBank) Cellulase M related protein
Organism
afl  Anoxybacillus flavithermus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
564896..565990
Genome map
AA seq 364 aa AA seqDB search
MTDVKKLDETLTMLKALTDAKGVPGNEREVREVMRSYIAPYADEVTTDRLGSLIAKKVGK
ENGPKVMIAGHLDEVGFMVTQIDEKGFIRFQPLGGWWGQVMLAQRVTIVTKKGDITGVIG
SKPPHILPVEARRKPVEIKDMFIDIGASSRDEALAWGVRPGDAIVPYFEFTVMNNEKMLL
AKAWDNRIGCAVAIDVLKQLKDVEHPNVVYGVGTVQEEVGLRGARTSAFAIEPDIAFAVD
VGIAGDTPGVSEKDAMGKLGGGPHIVLYDATLVSHKGLREFVVNVAEEMNIPYRFDAMPG
GGTDAGAIHMMMRGVPALTISIPTRYIHSHAALLHRDDYEQTVKLLVEVIRRLDEEKVKE
ITFD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgacagatgtgaaaaagctcgatgaaacgttaacgatgttgaaagcgttaacggatgca
aaaggcgttccagggaatgaacgggaagtacgtgaagtgatgagatcgtatatcgctccg
tatgcggatgaagtgacgacggatcgtctcggtagcttaattgcaaaaaaagtaggaaaa
gaaaatggaccaaaagtgatgattgcaggtcatttagatgaagttggttttatggtgaca
caaattgatgaaaaaggctttattcgtttccaaccgcttggcggctggtgggggcaagtc
atgcttgctcagcgcgtgacaatcgtgacgaaaaaaggcgacattacaggtgttatcgga
tcgaagccgccacatattttacctgtagaagcaagaagaaagcctgttgaaataaaagat
atgtttattgacatcggggcttctagccgagatgaagcgcttgcttggggggtgcgccct
ggcgatgcgattgtaccatattttgaatttacggttatgaacaatgaaaaaatgttgctt
gcgaaagcatgggataaccgcatcggttgcgcagttgctattgatgtgttgaaacaatta
aaagatgtggagcatccaaacgtcgtgtatggcgttggtacagtgcaagaagaagtgggc
ttgcgcggggcgcgaacatccgcttttgcgatcgaaccagatattgcatttgcggttgat
gttggcattgctggtgatacaccaggtgtatcagaaaaagatgcgatgggaaaactcgga
ggtggaccgcatatcgttttatacgatgcaacgctcgtttctcacaaaggattgcgagaa
tttgtcgttaacgttgcggaggaaatgaacatcccgtaccgctttgacgcgatgccaggc
ggtggaacagacgctggtgcgatccatatgatgatgcgcggcgttccagcgctcaccatt
tccatcccaacgcgctacattcactctcacgctgcccttcttcaccgcgatgactacgaa
caaacagtaaaactactagtcgaagtcattaggcgtctcgatgaagaaaaagtgaaagaa
attacgtttgattaa

DBGET integrated database retrieval system