KEGG   Anoxybacillus flavithermus: Aflv_0527Help
Entry
Aflv_0527         CDS       T00790                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afl  Anoxybacillus flavithermus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aflv_0527
Enzymes [BR:afl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Aflv_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
564896..565990
Genome map
AA seq 364 aa AA seqDB search
MTDVKKLDETLTMLKALTDAKGVPGNEREVREVMRSYIAPYADEVTTDRLGSLIAKKVGK
ENGPKVMIAGHLDEVGFMVTQIDEKGFIRFQPLGGWWGQVMLAQRVTIVTKKGDITGVIG
SKPPHILPVEARRKPVEIKDMFIDIGASSRDEALAWGVRPGDAIVPYFEFTVMNNEKMLL
AKAWDNRIGCAVAIDVLKQLKDVEHPNVVYGVGTVQEEVGLRGARTSAFAIEPDIAFAVD
VGIAGDTPGVSEKDAMGKLGGGPHIVLYDATLVSHKGLREFVVNVAEEMNIPYRFDAMPG
GGTDAGAIHMMMRGVPALTISIPTRYIHSHAALLHRDDYEQTVKLLVEVIRRLDEEKVKE
ITFD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgacagatgtgaaaaagctcgatgaaacgttaacgatgttgaaagcgttaacggatgca
aaaggcgttccagggaatgaacgggaagtacgtgaagtgatgagatcgtatatcgctccg
tatgcggatgaagtgacgacggatcgtctcggtagcttaattgcaaaaaaagtaggaaaa
gaaaatggaccaaaagtgatgattgcaggtcatttagatgaagttggttttatggtgaca
caaattgatgaaaaaggctttattcgtttccaaccgcttggcggctggtgggggcaagtc
atgcttgctcagcgcgtgacaatcgtgacgaaaaaaggcgacattacaggtgttatcgga
tcgaagccgccacatattttacctgtagaagcaagaagaaagcctgttgaaataaaagat
atgtttattgacatcggggcttctagccgagatgaagcgcttgcttggggggtgcgccct
ggcgatgcgattgtaccatattttgaatttacggttatgaacaatgaaaaaatgttgctt
gcgaaagcatgggataaccgcatcggttgcgcagttgctattgatgtgttgaaacaatta
aaagatgtggagcatccaaacgtcgtgtatggcgttggtacagtgcaagaagaagtgggc
ttgcgcggggcgcgaacatccgcttttgcgatcgaaccagatattgcatttgcggttgat
gttggcattgctggtgatacaccaggtgtatcagaaaaagatgcgatgggaaaactcgga
ggtggaccgcatatcgttttatacgatgcaacgctcgtttctcacaaaggattgcgagaa
tttgtcgttaacgttgcggaggaaatgaacatcccgtaccgctttgacgcgatgccaggc
ggtggaacagacgctggtgcgatccatatgatgatgcgcggcgttccagcgctcaccatt
tccatcccaacgcgctacattcactctcacgctgcccttcttcaccgcgatgactacgaa
caaacagtaaaactactagtcgaagtcattaggcgtctcgatgaagaaaaagtgaaagaa
attacgtttgattaa

DBGET integrated database retrieval system