KEGG   Anoxybacillus flavithermus: Aflv_2739Help
Entry
Aflv_2739         CDS       T00790                                 

Gene name
mmgA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
afl  Anoxybacillus flavithermus
Pathway
afl00071  Fatty acid degradation
afl00072  Synthesis and degradation of ketone bodies
afl00280  Valine, leucine and isoleucine degradation
afl00310  Lysine degradation
afl00362  Benzoate degradation
afl00380  Tryptophan metabolism
afl00620  Pyruvate metabolism
afl00630  Glyoxylate and dicarboxylate metabolism
afl00640  Propanoate metabolism
afl00650  Butanoate metabolism
afl00900  Terpenoid backbone biosynthesis
afl01100  Metabolic pathways
afl01110  Biosynthesis of secondary metabolites
afl01120  Microbial metabolism in diverse environments
afl01130  Biosynthesis of antibiotics
afl01200  Carbon metabolism
afl01212  Fatty acid metabolism
afl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:afl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Aflv_2739 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    Aflv_2739 (mmgA)
   00640 Propanoate metabolism
    Aflv_2739 (mmgA)
   00650 Butanoate metabolism
    Aflv_2739 (mmgA)
  Lipid metabolism
   00071 Fatty acid degradation
    Aflv_2739 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    Aflv_2739 (mmgA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aflv_2739 (mmgA)
   00310 Lysine degradation
    Aflv_2739 (mmgA)
   00380 Tryptophan metabolism
    Aflv_2739 (mmgA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aflv_2739 (mmgA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Aflv_2739 (mmgA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Aflv_2739 (mmgA)
Enzymes [BR:afl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Aflv_2739 (mmgA)
Exosome [BR:afl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aflv_2739 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ACJ35092
UniProt: B7GMJ0
Position
complement(2727039..2728241)
Genome map
AA seq 400 aa AA seqDB search
MTKRGRNMGKTVIVSGVRTPFGKFGGSLSALSAAQLGGIAIKEALVRAHVNAEHVDEVVF
GTVLQGGQGQLPSRQAAREAGIPWETKTETINKVCASGMRSVTLGDQIIRAGDADVIVAG
GMESMSNAPYMLPKARWGLRMGDSTVKDLMVYDGLTCSFTGVHMGIYGSETAKELSITRE
EQDRWAYRSHQLAIAAIESGKLAEEIVPVAIPQRKGEPITVAIDESPRKDTSLEKLAKLA
PVFDPTGTITAGNAPGVNDGACALVLMSEERAQKEGLTPLATIVAHAAIAVEAKDFPKTP
GIVINELLRKTGKTVHDIDLFEINEAFAAVALASMKIADLPEEKVNVNGGAIALGHPIGA
SGARIIITLIHELKRRGGGTGIAAICSGGGQGDAIMIEVH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaagggggagaaacatggggaaaacggtcattgttagcggggtacgtacgcca
tttgggaaatttggaggaagtttaagcgcattgagcgcagcacaacttggaggcattgcg
atcaaagaagcgttagtgcgcgcacatgtgaatgcagaacatgtcgatgaagtcgtattt
ggcaccgtattgcaaggtggacaagggcaacttccatcgcggcaagcggctagagaagca
ggcattccatgggagacgaaaacagaaacaatcaataaagtatgcgcctctggtatgcgc
agcgtcacgcttggcgatcaaatcattcgcgcaggggatgcggacgtcatcgtggcaggt
ggaatggagtcgatgagcaatgccccgtatatgttgccgaaagcgcgttggggtttgcgc
atgggcgattcgacagtaaaagatttaatggtgtatgacggattaacatgcagcttcaca
ggtgtgcatatgggtatttatggaagtgaaacagcgaaagaattaagtattacgcgtgag
gagcaagaccgttgggcgtatcgtagccatcaattagcgattgcggcgatcgaaagtgga
aagctagcagaagaaatcgtccctgttgccattccgcaacgaaaaggagagccgatcacg
gtagcgattgatgaatcaccacgaaaagatacatcgcttgaaaaattagcaaaactggcg
cccgtgtttgatccaacaggcacgattacggcaggaaatgcgccaggcgtaaatgacgga
gcttgcgcgcttgtattaatgagcgaagagcgcgcgcaaaaagaagggcttactccgctt
gcgacgattgttgctcatgcggccattgcggtagaagcgaaagattttccgaaaacacca
ggcatcgtcatcaatgaattgttgcgcaaaacaggaaaaaccgtacatgacattgattta
ttcgaaattaacgaagcgtttgcagccgtcgctttagcaagcatgaaaattgctgatttg
ccagaagaaaaagtgaacgtcaacggtggcgccattgcgctcgggcatccgatcggtgca
agcggtgcgcgcattattattacgttaattcatgaattaaaacgccgtggtggcggcacg
ggtattgcagcgatttgtagcggaggcggtcaaggcgatgcaataatgattgaagttcat
taa

DBGET integrated database retrieval system