KEGG   Actinoplanes friuliensis: AFR_07020Help
Entry
AFR_07020         CDS       T02892                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
afs  Actinoplanes friuliensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFR_07020
   00051 Fructose and mannose metabolism
    AFR_07020
Enzymes [BR:afs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     AFR_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1543132..1544319
Genome map
AA seq 395 aa AA seqDB search
MSVQPTREDKFSFGLWTVGWTARDPFGDATRAPLDPIEAVHKLSELGAYGITFHDDDLVP
FGSDAPARDGVIANFKKALDETGMVVPMVTTNLFTHPVFKDGGFTSNDRSVRRYALRKVL
RNMDLAADLGAKTFVLWGGREGSEYDVAKDVQAALDRYAEGLNLLAQYSEDNGYGLRFAI
EPKPNEPRGDILLPTAGHAIAFVNDLERPELFGINPEVGHEQMSNLNFAQGIAQALWHGK
LFHIDLNGQHGPKFDQDLVFGHGDLLNAFALVDLLEHGGPGGGPGYDGPRHFDYKPSRTE
DYTGVWESAKANMRMYLLLKERAQAFRADPAVQEALAESKVLELSKPTLNEGETYTDLLN
DRSAFEDYDVDAAGEQGYHFVKLHQLAIDHVLRAN
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtacagcccacgcgcgaagacaagttctcattcggcctctggaccgtgggctgg
accgcccgcgacccgttcggtgacgcgacccgggccccgctcgacccgatcgaggccgtg
cacaagctctccgagctgggtgcgtacggcatcacgttccacgacgacgacctcgtcccg
ttcggctcggacgcgcccgcccgtgacggcgtcatcgcgaacttcaagaaggccctggac
gagaccggcatggtggtgccgatggtgaccaccaacctgttcacccatccggtgttcaag
gacggcggtttcaccagcaacgaccgcagcgtccggcgctacgccctgcgcaaggtcctg
cgcaacatggacctcgccgccgacctgggcgcgaagacgtttgtcctgtggggcggccgt
gagggttccgagtacgacgtggccaaggacgtccaggccgcgctcgaccgctacgccgag
ggtctcaacctgctcgcgcagtattccgaggacaacggctacggtctgcgcttcgccatc
gagcccaagcccaacgagccccgcggcgacatcctgctgcccacggccggtcacgcgatc
gccttcgtgaacgacctcgagcgcccggagctcttcggcatcaaccccgaggtcggccac
gagcagatgtcgaacctcaacttcgcgcagggcatcgcccaggcgctgtggcacggcaag
ctcttccacatcgacctcaacggtcagcacggccccaagttcgaccaggacctggtcttc
ggccacggtgacctgctcaacgcgttcgcgctggtggacctgctcgagcacggcggcccc
ggcggcggccccggttacgacggcccgcggcacttcgactacaagccctcgcgcaccgag
gactacaccggcgtgtgggagtcggcgaaggccaacatgcggatgtacctgctgctcaag
gagcgggcgcaggcgttccgcgccgacccggcggtccaggaggcgctggccgagagcaag
gtgctcgagctgtcgaagccaaccctgaacgagggcgagacctacaccgacctgctgaac
gaccgcagcgccttcgaggactacgacgtcgacgcggccggcgagcaggggtaccacttc
gtgaagttgcaccagctcgccatcgatcatgtgctgcgcgccaactga

DBGET integrated database retrieval system