KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_ABR222WHelp
Entry
AGOS_ABR222W      CDS       T00167                                 

Definition
(RefSeq) ABR222Wp
  KO
K05692  
actin beta/gamma 1
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Phagosome
Brite
KEGG Orthology (KO) [BR:ago00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    AGOS_ABR222W
Transcription machinery [BR:ago03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     AGOS_ABR222W
Messenger RNA biogenesis [BR:ago03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     AGOS_ABR222W
Chromosome [BR:ago03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     AGOS_ABR222W
    NuA4 complex
     AGOS_ABR222W
  Chromatin remodeling factors
   BAF complex
    AGOS_ABR222W
   PBAF complex
    AGOS_ABR222W
   SWR1 complex
    AGOS_ABR222W
Mitochondrial biogenesis [BR:ago03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    AGOS_ABR222W
Cytoskeleton proteins [BR:ago04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     AGOS_ABR222W
Exosome [BR:ago04147]
 Exosomal proteins
  Proteins found in most exosomes
   AGOS_ABR222W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:join(818971..818980,819284..820404)
Genome map
AA seq 376 aa AA seqDB search
MDSGEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQ
SKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKM
TQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRID
LAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKS
YELPDGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVM
SGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISK
QEYDESGPSIVHHKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggattctggagaagttgcagcattagtgatcgacaacggttcggggatgtgcaaggcc
ggtttcgccggtgacgacgctccccgggctgtgttcccttcgatcgtcggcagacccaga
caccagggtatcatggtgggtatgggccagaaggactcctatgtgggcgatgaggcgcaa
tcgaagagaggtatcttgacgttgcgttacccaatcgagcacggtatcgtcacaaactgg
gatgacatggagaagatctggcaccacaccttttacaacgaattgagagtggccccagag
gaacacccagtgttgttgacggaggcgcctatgaaccctaagtcgaacagagaaaagatg
acgcagatcatgtttgaaactttcaacgtgcctgccttctacgtgtccattcaggccgtc
ttgtcgctatactcttctggtagaacgacgggtattgtgttggactccggtgacggtgtt
acccacgttgttcctatctacgctggtttctcgttgccacacgccattttgagaattgac
ttggccggcagagatatgaccgactacttgatgaagattctatcggaacgtggctactcc
ttttccaccactgcagagagagaaattgtccgtgacatcaaagagaagctatgttacgtc
gccttggacttcgaacaagagatgcagactgctgcccagtcttcggccatcgagaagtcc
tacgagctacctgacggtcaggtgatcactatcggtaacgaaagattcagagctccagaa
gctttgttccatccatctgtgttgggcttggaggctgccggtattgatcaaaccacctac
aactccatcatgaagtgtgacgtggacgtcagaaaggagctctacggtaacattgtgatg
tctggtggtactactatgttccctggtatcgccgagagaatgcagaaggagatcacggcc
ttggcgccatcctccatgaaggtgaagattatcgctccaccagagagaaagtactccgtc
tggatcggtggttctatcttggcctctctaaccaccttccagcagatgtggatctcgaag
caggaatacgatgagtctgggccatccatcgttcaccacaagtgtttctaa

DBGET integrated database retrieval system