KEGG   Ashbya gossypii (Eremothecium gossypii): AGOS_AFR048WHelp
Entry
AGOS_AFR048W      CDS       T00167                                 

Definition
AFR048Wp
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ago  Ashbya gossypii (Eremothecium gossypii)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ago00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AGOS_AFR048W
Enzymes [BR:ago01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AGOS_AFR048W
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:517129..518292
Genome map
AA seq 387 aa AA seqDB search
MVHYRLAAAMLGAAACAQAAQPSPEELWGFDVGTAGIQTFAHLPHERCLLQPDLEFDIGI
LGMPFDMSVTYRPGARFGPEAIRRGSQRQIRAHAYSPYRALNPYDDWAHIVDCGDVPVVL
TDNRIARDMMHRAYADVLRRSSKSDPRVPPRIIMLGGDHSVLLPALRALHDVYGPISVVH
FDSHIDTWQPANTSVWDTAHVPLNHGTMLWEAFQHGLLSDHNVHVGLRSNLAHPDDFHRD
DAAGFYRIHADEILDIGPQGVVDRILRVIPRGVPVYVSVDIDVLDPSAAPATGTVEPGGW
LPRELLRVLRGLQPLTLVGADIVEVAPAYDRADITAITAAQLVYELAASMVASGPVAHTL
LDTRADSAAVPAQVRFRARGPSRSATA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggtccactaccgcttggctgccgccatgttgggcgcggctgcgtgcgcacaggccgcg
cagccgtcgccggaagagctgtgggggtttgacgtgggcaccgcgggtatccagacgttt
gcgcacctaccgcacgagcgctgcctgctccagccagacctggagtttgacatcggcatc
ctcggcatgccattcgacatgtccgtgacctaccggcccggcgcgcgcttcggccccgag
gccatccgccgcggctcacagcgacagatccgcgcacacgcctacagcccctaccgcgcg
ctcaacccctacgacgactgggcgcacatcgtcgactgcggcgacgtgcccgtcgtgctg
acggacaaccgcatcgcgcgcgacatgatgcaccgcgcgtacgccgacgtcctgcgccgc
agctccaagagcgacccccgcgtcccgccgcgcatcatcatgctcggcggcgaccacagc
gtgctgctgcccgcgctgcgcgcgctccacgacgtctacggccccatctccgtcgtccac
ttcgactcacacatcgacacctggcagcccgccaacactagcgtctgggacaccgcccac
gtgcccctcaaccacggcaccatgctctgggaggccttccagcacggcctgctctccgac
cacaacgtccacgtcggcctgcgctcgaacctcgcccaccccgacgacttccaccgcgac
gacgccgccggcttctaccgcatccacgcagacgagatcctcgacatcgggccccagggc
gtcgttgaccgcatcctccgcgtcatcccccgcggcgtgcccgtctacgtatccgtcgac
atcgatgtgctcgaccccagcgccgccccggccaccggcaccgtcgagcccggcggctgg
ctcccgcgcgagctgctccgcgtgttgcgcggcctgcagccgctgacgctcgtcggcgcc
gacatcgtcgaagttgccccggcctacgaccgcgctgacatcacggctatcacggccgcg
cagctggtctacgagctcgccgccagcatggtcgcgtccggacccgtcgcccacaccttg
ctcgacacccgcgctgattctgccgcggtccccgcccaggtccgttttcgcgcgcgcggt
ccctctcgatccgcgactgcatag

DBGET integrated database retrieval system