KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_2616Help
Entry
AHA_2616          CDS       T00424                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AHA_2616
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_2616
   00620 Pyruvate metabolism
    AHA_2616
   00650 Butanoate metabolism
    AHA_2616
  Lipid metabolism
   00071 Fatty acid degradation
    AHA_2616
  Amino acid metabolism
   00350 Tyrosine metabolism
    AHA_2616
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AHA_2616
   00626 Naphthalene degradation
    AHA_2616
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AHA_2616
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AHA_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2914021..2916696
Genome map
AA seq 891 aa AA seqDB search
MAVTNMAELDALVARVKEAQREFASFSQEQVDKIFRAAALAASNARIPLAQMAVEESGMG
IIEDKVIKNHFASEYIYNKYKEEKTCGILSEDDEMGTITIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKNSTNTAAKLVLDAAIAAGAPKDIIGWIDQPTVELSNA
LMKHNDINLILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADVKRAVASILMSKTF
DNGVVCASEQAVIVVDSIYDQVKERFATHNGYVLTKEEADKVRKVILINGAMNANIVGQP
ATKIAEMSGVTVPPTTKILIGEGLEVCEEEEFAHEKLSPTLGMFRAKNFEEAVEMACTMV
NLGGIGHTSGLYTDQDRNADRIKYFGDKMKTARILINTPTTQGGIGDLYNFAIAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALGDLEGKKRA
LVVTDRFLFNNGYADEVVRLLKGLKMEVEVFYEVEADPTLSVVRKGAEMAHSFKPDVIVA
LGGGSPMDAAKIMWVMYEHPETAFEDLAMRFMDIRKRIYKFPKMGVKAELVCITTTSGTG
SEVTPFAVVTDDATGMKYPLADYELTPNMAIVDANLVMGMPKSLCAFGGIDAVTHAMEAY
VSVLANEYSDGQALQALKLLKEYLPSSYQNGANDPVAREKVHNAATIAGIAFANAFLGVC
HSMAHKLGAEFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVADHL
GLTAAGDRTAAKIEKLLVWLDELKATLGIPASIREAGVSEADFLAKVDQLAVEAFDDQCT
GANPRYPLISELKAILLDTYYGRPFTEDAQVAAKVEAKVEAKVEAKKKSKA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaccaatatggctgaactggatgcactggtcgcccgcgtcaaagaagcacag
cgtgaattcgccagcttctcgcaagagcaggtagacaagatcttccgtgccgccgccctg
gccgccagcaatgcccgtatccccctggcccagatggccgtggaagagtccggtatgggt
atcatcgaagacaaggttatcaagaaccacttcgcctccgaatacatctacaacaagtac
aaagaagagaagacctgcggcatcctcagtgaagatgacgagatgggcaccatcaccatc
gccgagccggtaggtatcatctgcggtatcgtaccgaccaccaacccgacctccactgcg
atcttcaaatcactgatctccctgaagacccgcaacgccatcatcttctccccgcatccc
cgtgccaagaactccaccaataccgctgccaagctggtactggatgcagccattgccgcc
ggtgcgccgaaagacatcatcggctggatcgatcaaccgaccgttgaactctccaacgcc
ctgatgaagcacaacgacatcaacctgatcctggccaccggtggcccgggcatggtgaaa
gccgcttactcctctggcaagcctgccatcggtgtaggtgccggtaacgtgcctgttgtt
atcgacgaaactgccgatgtgaagcgcgccgtcgcctccatcctgatgtccaaaaccttc
gacaacggcgtggtctgtgcctccgagcaagccgtcatcgtggttgactccatctatgac
caggtgaaagagcgtttcgcgactcacaacggttatgtgctgaccaaagaagaagctgac
aaggtccgcaaggtcatcctgatcaacggtgccatgaacgccaacatcgtgggccagcct
gccaccaagatcgccgaaatgtccggtgtgaccgtgccccccaccaccaagatcctcatc
ggtgaaggtctggaagtgtgtgaagaggaagagttcgctcatgagaagctctccccgact
ctgggtatgttccgtgccaagaactttgaagaagccgtcgaaatggcctgcaccatggtc
aacctgggtggtatcggccacacctccggtctgtacaccgaccaggatcgcaacgccgac
cgcatcaagtacttcggcgacaagatgaagaccgcccgtatcctgatcaataccccgacc
acccagggtggtatcggtgacctgtacaactttgccatcgcaccgtccttgacgctgggt
tgcggttcctggggtggtaactccatctccgaaaacgtgggtcccaagcacctgatcaac
aagaagacagtcgcaaaacgggcagaaaatatgctgtggcacaaacttccgaaatccatc
tacttccgtcgtggttccctgccgatcgccctgggcgacctggaaggtaaaaaacgcgca
ctggtcgtgaccgaccgcttcctgttcaacaacggctacgccgacgaagtggttcgtctg
ctcaagggcctgaagatggaagtggaagtgttctacgaagtagaagccgacccgactctg
tctgtagtacgcaaaggcgccgagatggcccactccttcaagccggacgtgatcgtcgcg
ctgggcggtggttcaccgatggatgcggccaagatcatgtgggtgatgtacgagcacccg
gaaaccgcgttcgaagatctggccatgcgcttcatggacatccgcaagcgtatctacaag
ttcccgaaaatgggcgtgaaggccgaactggtctgtatcaccaccacttccggtaccggt
tctgaagtgaccccgttcgcggtcgtgaccgacgacgccaccggcatgaaatacccgctg
gccgactacgagctgaccccgaacatggccatcgttgacgccaacctggtcatgggcatg
cccaaatccctgtgtgccttcggcggtatcgatgccgtgactcacgccatggaagcctac
gtttccgtactggccaacgagtactccgacggtcaggcgctgcaagccctgaaactgctg
aaagagtacctgccgtccagctaccagaacggtgccaacgacccggttgctcgcgagaaa
gtacacaacgccgccaccatcgccggtatcgcgttcgccaacgccttcctgggtgtgtgc
cactccatggctcacaaactgggtgccgagttccacattccgcacggtctggccaacgcc
ctgctgatcagcaacgtgatccgctacaacgccaacgacaacccgaccaagcagactgcg
ttctcccagtacgaccgtccgcaggctcgtcgtcgctacgccgaagtggccgaccacctg
ggtctgactgccgccggtgaccgtaccgccgccaagatcgagaagctgctggtatggctg
gacgagctgaaagccaccctgggcatcccggcctccatccgtgaagccggcgtgtctgaa
gctgacttcctggccaaggttgaccagctggccgtggaagccttcgatgaccagtgcacc
ggcgccaacccgcgctacccgctgatcagcgagctgaaagccatcctgctggacacctac
tacggccgtcccttcaccgaagacgctcaggtagcggccaaggttgaagccaaggttgaa
gccaaggttgaagccaagaagaagtccaaagcctga

DBGET integrated database retrieval system