KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3689Help
Entry
AHA_3689          CDS       T00424                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aha00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4119888..4121219)
Genome map
AA seq 443 aa AA seqDB search
MFLPQEIIRKKRNGEALSTQEIQFFVQGITNNTIGEGQIAALAMAVYFKDMTMDERVALT
CAMRDSGMVLTWDHLNLGGPIVDKHSTGGVGDVVSLMLGPMVAACGGFVPMISGRGLGHT
GGTLDKLDAIPGYQTSVDNDRFLKVVKEAGVAIIGQTGDLAPADKRIYAVRDITATVESI
AMITGSILSKKLASGLEALVMDVKVGSGAFMPTFEASEELAKSIVAVANGAGCRTSALLT
DMNQVLASSAGNAVEVREAVRYLTGEYRNPRIHAVTMALCAEMLISAGLASDDGEARRKL
QAVLDNGKAAEIFGRMVTGLGGPSDFMERYDHHLPKAAIVRPVYAANSGFVTAMDTRELG
LAVVAMGGGRRAAGDKLDYAVGLTDFIRLGQSVEADKPLALIHAQTEEQFAQAASMVQAA
VKIGDTRPEALPEVYRRIGLADL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttttgcctcaagaaattattcgcaagaagcgcaacggtgaagcgctcagtacccaa
gagattcaattcttcgttcagggcattaccaacaacaccatcggcgagggccagattgcg
gcgctggcgatggcggtctacttcaaagacatgaccatggatgagcgggttgccctgacc
tgcgccatgcgcgattccggcatggtgctgacctgggaccacctcaatctgggtggcccg
atcgtcgacaagcactccaccggcggtgtgggtgacgtcgtctccctgatgctcggcccg
atggttgccgcctgcggcggtttcgtgccgatgatctccggccgtggcctgggccacacc
ggcggtaccctcgacaagctggatgccattcctggctaccagacctcggtcgacaacgat
cgtttcctgaaagtggtgaaagaggctggtgtcgccatcatcggccagaccggcgatctc
gccccggccgacaagcgtatctatgcggtacgggacatcactgccaccgtcgaatccatt
gccatgatcaccggctccatcctctccaaaaagctcgcctccgggctggaagcgctggtg
atggatgtgaaagtgggctccggtgccttcatgccgacctttgaagcctccgaagagctg
gccaagagcatagtcgcggtggccaacggcgctggctgtcgcacttcagcactcttgacc
gacatgaaccaggtgctggcctccagcgccggcaacgcggtggaagtgcgcgaagcggtg
cgctacctgaccggtgaataccgcaacccgcgcattcacgccgtcaccatggcactgtgt
gccgagatgctgatctccgccggcctggccagcgatgacggcgaggcccgccgcaagctg
caggcggtgctcgacaatggcaaggcggccgagatcttcggtcgcatggtgaccggcctc
ggcggcccgagcgacttcatggagcgctacgatcaccacctgccgaaggccgccatcgtg
cgccctgtctatgctgccaacagcggtttcgtgaccgccatggacacccgtgaactgggt
ctggccgtggttgccatgggcggtggtcgtcgcgctgccggtgacaaacttgattatgcg
gtcggtctgaccgactttatccgcctgggtcaaagtgtcgaggcagacaagccgctcgcc
ctgatccacgctcaaactgaagagcaattcgctcaggctgccagcatggtgcaggccgcc
gtcaagatcggtgacacccgaccagaggcattgcccgaggtctaccgtcgcatcggtctg
gctgatttgtaa

DBGET integrated database retrieval system