KEGG   Acidaminococcus intestini: Acin_0756Help
Entry
Acin_0756         CDS       T01639                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ain  Acidaminococcus intestini
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acin_0756 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acin_0756 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acin_0756 (thrC)
Enzymes [BR:ain01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acin_0756 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769641..771110
Genome map
AA seq 489 aa AA seqDB search
MVSSAHAISSGLAKDGGLFVPRDFPPVALAEIDAMKGKPYGDRAVQILSRYLTDFSEEEL
RECVSAAYSKEKFGGFAAPLHLLKKDTDILELWHGPTSAFKDMALQILPHFLTRAVRKTG
EQKKSVILVATSGDTGKAAMAGFSDVPDTEVIVFYPHGGVSDAQRLQMTTQRGNNVHAVA
VEGNFDDAQTGVKLLFGKAELAAELKEQGCAFSSANSINWGRLVPQIVYYFSAYADAVEK
GRIQNGTEIVFSVPTGNFGDILAGYYAKLMGLPVKKFICASNSNNVLTDFINTGTYDRNR
EFHRTISPSMDILVSSNLERLLYEKTEHNSEKINEWMDALQEKGAYSIGRDIQDAVVSDF
FGAWIDEIETQETISDVFNNYGYVLDPHSAVAYKALQKYRLMTSDETYGIVLSTASPFKF
SDVVLRALYPDDYEGKVLTAFEAMDELSQKARIDIPQGLKELRGLPERESDIVAPGEMEK
EVKKILAID
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtgagctctgcccacgctatttccagtgggctggccaaagacggcggtctttttgtg
ccccgggattttcctcctgtggcccttgctgagatcgatgccatgaagggtaagccttat
ggcgaccgtgccgtacagatcctttcccggtacctgacggatttttcggaggaggaactt
cgggaatgtgtttcagctgcttacagcaaagaaaagtttggcggttttgcagcgccgctt
catcttctcaaaaaggatactgatattctggaactatggcatggtccaacgagtgccttt
aaggatatggcactccagatcctgcctcatttccttacgagagccgtccgcaagacgggc
gaacaaaaaaagagcgtgattctcgttgcgacaagcggcgatacgggaaaagcggctatg
gccggattcagtgatgtgccggatacagaagtcatcgtcttttatccccatggcggggtc
agcgatgcccagcgcctgcagatgacgacgcagcgggggaataatgtccatgctgttgcg
gttgaaggcaattttgatgatgcccagactggggtcaaattgctttttggcaaagcggag
cttgcagctgagctgaaggagcaaggctgcgctttttcttctgcaaattccatcaactgg
ggccgcttggtgccgcagatcgtctattatttcagcgcctatgccgatgctgtggaaaag
ggacgtatccaaaatggtacggaaatcgtcttttctgttcccacgggcaacttcggtgat
attcttgccggctactatgccaagctcatgggcctgccagtgaagaagttcatctgcgcg
tcaaacagcaacaatgtcctgaccgatttcatcaacacggggacctatgatcggaaccgc
gagtttcatcgaaccatttccccgtccatggacatccttgtttcaagtaacttggaacgg
ctcctttatgaaaagaccgagcataactctgagaaaatcaacgagtggatggatgccctc
caggaaaaaggcgcctattccattggacgtgatatccaggatgccgttgtcagtgacttc
tttggggcttggatcgatgaaatcgaaacccaggaaacaattagtgatgtcttcaataac
tatggctatgtccttgatccccattcagctgttgcctataaggccctacagaagtatcgc
ctcatgaccagcgacgagacgtacggcattgtcctttcaacggccagcccgttcaagttc
agcgatgtggtcctgcgggccctttatcctgatgactatgaaggcaaggtcctgacggct
tttgaggccatggatgagctgagccaaaaggctcgaatcgacattccgcagggcctcaag
gaactgcgcggcctgccggaacgggaaagcgatatcgtggccccgggcgaaatggaaaag
gaagtcaagaagattcttgccattgactaa

DBGET integrated database retrieval system