KEGG   Ajellomyces capsulatus: HCAG_05807Help
Entry
HCAG_05807        CDS       T02229                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
aje  Ajellomyces capsulatus
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aje00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    HCAG_05807
Enzymes [BR:aje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     HCAG_05807
Peptidases [BR:aje01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   HCAG_05807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1099 aa AA seqDB search
MGGEDPSRGIGASSRSVPQSHSNHTVERLEDITASMKIDEGASLNELLRTSEDSIQNSKI
SLANGKLDLAFDDYLRASEITINAIPNHADYYYMRRQHPGWNDRFIKMLATIRSQEETMS
SVKHKIDQSKKSLNGHQTTSPAQGKLSRTSPTEVDSAYSPSLPMHRRSQPSNEPPLRMPS
PSNFQPKRPASVTPQSYSISQPNTEQRPGSEIPRKQVNSEISASDNLALRFAELRRSRQN
RSSNAAEQNGIPHSSTSSPSSPAERPLSRDNALNYPNSRPLGPRDMSSSRNPPVIPPKVP
LHVANTSLPRYPSPAYSPVWTVPWQPPSNPPKTSTDTANPGISLQTPSLNGSLSDNLNGY
NGDSPYRSQTPNSVYSRGDAPSRSADIPLQPTIHPDRLYDYLQKYDVLLIDVRPRDRFDA
GHIYSKSIICIEPVALKENVSAEELEDRLVLSPEVEQSLFGRRNEFDLVVYYDQNTREAS
YLVGSPAGSSLPHLRAIYDTLYEFNAYKPLKDGRQPALLVGGLDAWIDLVGPHALATSKT
AAVMSSIHARRPAQVAAKPLKRVPTASANSSWEVRKRRLREYKPLNPEEERVWLEKARNE
EIDPSTYVAEDGAITEEPDGYDNQEHPSPFVHDYEDFFRRFPEPHDIRQSMVGAHAQAIS
PQIPLPEPSLPPSLPRPTPAVPRPIYSGVSEGRHVQAPLARQSSASKTALYASSSPIDRM
KLPRTGLVNMGSTCYMNAIIQCLSVTVQLTKFFIDNRFHSQVQKNWKGSQGILPGLFANL
VRSLWKNDVEVIRPTSFRNFIGRLNPEWAGSRQQDAKEFFDVLLDCLHEDLNLNWNRTPL
RPLTTEQEMRREQMPIEQVSTIEWNRYCHREYSYISSLFAGQHASRLRCRTCRRTSTTYE
AFFSISVEIPTSPASGAGDLYQCLNSYCQEEMLSGDEVWKCPYCRSEREATKQIILTRAP
RFLVIHFKRFSLSRYQQTRKIHTAINFPITGLDITSFMAPPIRTSSAPNGRTDGNNNQLQ
PELATTPPYIYNAYGIVRHIGSSSSEGHYISLVRDDRRGCWRKFDDQRVTDFNPMGLKPA
DSLQNDQAYLVFYERKLAY
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgaggacccatcccgggggataggtgcctcttcaagatctgttccgcaaagc
cattcgaatcatactgttgagcgacttgaggatatcactgcgtccatgaaaattgatgag
ggagcatccctgaacgaactactccgcacctcggaagattccatccaaaattccaagata
tccctagcaaatgggaaactagatctagccttcgatgactatctccgggcttcagaaatc
actatcaacgccataccaaatcacgcagattattattatatgagacgacaacatccgggg
tggaatgatcggtttataaaaatgttggcaactattcgatcgcaagaagaaactatgtcg
agcgtaaagcacaagattgaccaaagcaaaaagtccctcaacggccatcaaacaacttct
cccgctcaggggaagctttcccgcacatctcccaccgaagtagattctgcttatagccca
tctctccctatgcatcgtcgcagccaaccctcgaatgaacctccacttcgcatgcccagc
ccatccaacttccagcccaagcggcccgcatctgttaccccacaaagttattctatcagt
cagccaaacactgagcagagacccggatcggagatccctcgcaaacaagttaattcagag
atcagtgcctcagataatcttgccctgagatttgcggagttgaggaggtcacgccaaaat
agaagttcaaatgcggctgagcagaatggcattcctcacagcagtacatcatccccatca
tctccagcagagcggccattatcaagagacaacgcattaaactaccctaactcaagacct
cttggaccccgcgatatgagctcatcgcgaaatcctcctgttataccgccgaaagttcca
ttacatgtagcaaacacctcacttcctcgctacccgagtccagcatatagtccagtgtgg
acagttccatggcaaccgccctcgaacccacccaagacatcaactgatactgctaacccg
ggtatatctctccagacgccgtctctcaatggctcactgagtgacaatctaaacggatat
aacggtgacagcccataccgatcccaaacgccaaatagcgtttactcgaggggagacgca
ccgagccgctccgcagacattcctctgcagccaactatacatccggataggctgtacgat
tatcttcaaaagtacgatgtattactcatcgatgtccgcccgcgggataggttcgacgcc
ggtcacatttattccaagtcaattatatgtatagagccggttgctcttaaagaaaatgtg
tccgctgaagagctcgaagatcggttggttctctctccagaggtggagcagtctcttttc
ggcagaaggaacgagttcgatttggttgtttactatgatcagaatacgcgggaggcgtcc
taccttgttggctctccagcaggtagcagcctaccacatctgcgggccatctacgacacc
ttatacgaattcaatgcttacaagcccctcaaggatgggcgacaacctgctcttttggtt
ggcgggcttgatgcgtggatcgatctcgttggccctcacgcattagctacttctaaaaca
gctgctgttatgagctcaatccatgctcggaggccagcccaggtcgcagccaaacctctt
aaacgagtacctactgctagcgcaaattccagctgggaagtaagaaagcgcaggttgcgt
gaatataaaccccttaaccccgaagaggaacgcgtctggctcgaaaaagctaggaatgag
gaaatcgacccttccacttatgtagcagaggatggggctatcacggaagagcctgatggc
tatgataatcaagagcaccccagtccgtttgtgcatgattatgaagatttctttagaagg
ttccccgaacctcatgatattagacagtccatggttggagcacatgcgcaagcaatctca
cctcaaattcctttgcctgaaccttctctacctccgtcacttcctcgtcctacgccggca
gttcctcgacccatatacagcggcgtgtctgagggtaggcatgttcaagccccccttgcc
cggcaatcatccgcgtctaaaacagcgttatatgcttcaagttcaccaattgaccgcatg
aaattaccacgcaccggcctcgtcaacatgggttcgacgtgttatatgaatgctatcatc
caatgtttgagcgtcaccgttcaactaaccaaattttttatcgacaatcgattccattcc
caagtacagaaaaactggaagggctcgcaaggtattcttcctggtttgttcgcgaacctc
gtaaggtcgttatggaaaaatgatgtcgaggttatccgtcctacgtcgtttcgaaatttt
attggacggctaaatcccgaatgggctggcagccgacaacaggacgcaaaggaatttttt
gacgttctcctcgactgcctacatgaagatctgaatttgaactggaatagaacaccgctc
aggccgctgacaactgaacaagaaatgcgccgcgaacagatgccaatcgaacaagtttca
acaatcgaatggaatcgatactgccaccgcgaatactcctacatttcctcattatttgcc
gggcaacatgccagccgacttcgctgcagaacatgccggcgtacttccaccacctatgaa
gcattcttcagtatcagtgttgaaattccgacatccccagcatcgggcgcaggagacctc
tatcaatgtctcaatagctactgccaagaggaaatgctcagcggtgacgaagtttggaag
tgcccatactgtcgttccgaacgcgaggccacaaaacagatcattctcacaagggctcct
cgtttcctcgtaatccattttaaacgcttttcgctctcccgttatcagcaaacgcgcaaa
atacacaccgctatcaacttccccattaccggcctagacatcacgtcgtttatggctccg
cccatccgcacctcatctgcccccaacgggagaactgatgggaacaataatcaactacag
ccggagcttgcgaccacccccccttacatttacaacgcctacggcatcgtccgccatata
ggctcctcaagtagtgaagggcactacatatccctcgtcagagatgaccgccgtggatgt
tggcgcaaatttgatgaccaacgagtgacagatttcaaccccatgggcttgaagccggct
gatagccttcaaaatgatcaggcataccttgtattttatgaacgaaagctagcatattag

DBGET integrated database retrieval system