KEGG   Alteromonas sp. SN2: ambt_02410Help
Entry
ambt_02410        CDS       T01513                                 

Definition
Sugar kinase, ribokinase family protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
alt  Alteromonas sp. SN2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ambt_02410
Enzymes [BR:alt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ambt_02410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(565166..566062)
Genome map
AA seq 298 aa AA seqDB search
MAIINFGSINIDHVYQVDHFVQPGETLASTHYQQLLGGKGANQSIALAQAGADVRHVGSI
HENDATFKQTLIKKGVDCRGVKCSETPSGHAIIQVTPSGENAIVLFGGANQTITADTVNK
ALLDTSSSDWVLTQNETSSIADVLRLAKESQLKVAFNPAPMSESVKALPLDCIDLLIVNE
TEAAALTDKEELDDILTVFKEQWSHCEVIITLGKAGVMMLRGNDTIEVEAFSVDAVDTTA
AGDTFIGYFLSAYSTHTDAKRALIRGCAASAIAVTREGAAQSIPTQKEVDRFLAKHTK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaataataaattttggctctattaatatcgatcatgtttatcaggtagatcacttc
gttcaacctggtgaaactcttgcgtctactcactaccaacaattacttggtggtaaaggt
gcgaaccagtcaattgccctagcgcaagccggtgcagatgttcgtcacgtaggcagcatt
catgaaaatgacgcaacgttcaaacaaacgctaattaaaaaaggcgtagattgtcgtggt
gttaaatgctctgaaaccccttcaggtcatgccattattcaagtaacgcccagtggcgaa
aatgctattgtgttatttggtggcgcaaaccaaaccattactgccgataccgtaaacaaa
gcgttgttagatacgtcgtcttctgattgggtacttacccaaaacgaaaccagcagtatt
gctgacgtacttcgcttggcaaaagaaagtcagcttaaagttgcctttaaccctgcacct
atgagtgagtcggttaaagcccttcctttagattgtatcgatttactgattgtaaacgag
acggaagcagcagcattaacggataaagaagaattagacgatattcttacggtatttaaa
gagcagtggtctcattgcgaagttattattacactaggtaaagcgggtgtaatgatgtta
agaggaaacgataccatagaagtggaagcgttttctgttgatgcagtagataccacagcc
gctggcgatacttttataggttactttttatctgcttacagtactcacactgatgcgaaa
cgtgcattaattagaggttgtgcagcttctgctattgcggttacccgagagggcgctgcg
cagagtattcctacgcagaaagaagtagaccgtttcttggcaaagcacactaaataa

DBGET integrated database retrieval system