KEGG   Alteromonas sp. SN2: ambt_05855Help
Entry
ambt_05855        CDS       T01513                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
alt  Alteromonas sp. SN2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ambt_05855
Enzymes [BR:alt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ambt_05855
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ambt_05855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1344606..1346807
Genome map
AA seq 733 aa AA seqDB search
MQVTRVKQIAQQLEHATCSQPFSVLGPIETGSKTKIRVWRPDASSIEISWPDTALPKVML
KPLTEAGLFEGEITKAQSAQVYWVTIHNKADSYIYCDPYQFVDNAYHAVHYIDSKPENLY
HQAGAQLITVTPEKGEALPATRFCVYAPNASSVSLIGDFNQWDGRLHPMEKTSLGYWVLV
VPNLGEGERYKYQIKDAHGHELPHKTDPLGFSAEQYPSHASKIFNHDKYQWNDDAWLASR
KQNKYANPMSIYEVHLGSWKRPDADSGQRYLTYEELADDLIPYAKEMGYTHLELLPVSEF
PFDGSWGYQPVGMFAPTSRFGNPDAFKYFVDKCHQADLGVIIDWVPAHFPEDGHGLARFD
GSHVYEYEDPRRGWHPDWNSCIYDFGKQTVRQFLVANALFWLDKFHVDGLRVDAVASMLY
LDYSRNEGEWIPNVDGGNENYEAISLLRWMNEEVYKHYPDAMTIAEESTSFPKVSRPVFE
GGLGFGFKWNMGWMHDSLTYIAKDPAYRNYHHGEITFSMVYSFDENFVLPISHDEVVHGK
GSLLHKMPGDEWQQAANVRCYAGFMYGHPGKKLNFMGNEFAQSKEWNHDTSLDWHLLEHK
KHKGIQSLYKALNQFYTSTPAMYEQDHSHHGFAWVDHENADQSVVSFVRTSLDGKQKVYV
ICNFTPIPREHYRVGVDGAGELALALNTDSQVFWGSDYPVDSHVTPTPVAWNNRDHSISI
NLPPLSTVFYITK
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtaacgcgggtaaagcagatagcgcagcaattagagcatgcaacatgttctcag
ccgttttccgttcttgggccaattgaaacaggaagtaaaactaagattcgagtatggcgt
ccagacgcatcatccatcgaaataagttggccagataccgcattgccaaaggttatgctg
aaaccgctcactgaagctggtttattcgagggtgaaattacaaaggcccaaagtgcgcag
gtttattgggtgactatccacaataaagccgatagctacatctattgtgacccttatcaa
ttcgttgataatgcataccacgctgtgcattacatcgacagcaaaccagaaaacctatat
caccaagccggtgctcaactcatcactgttacgcctgaaaaaggggaggcactccctgcc
actcgtttttgcgtgtacgcgccaaacgcttcttcagtttcattaattggtgactttaac
caatgggacggacgcttacatccaatggaaaaaacctcattgggctattgggtattggtt
gttccaaacctaggcgaaggggaacgttataagtatcaaattaaagacgcccacgggcat
gaattaccgcacaaaaccgatcctctagggtttagcgctgagcaatacccttctcatgcg
tcaaagatatttaaccacgataagtaccagtggaacgatgatgcatggctagcatctcgt
aaacaaaataaatatgccaacccaatgagtatttacgaagtgcacctaggctcgtggaag
cgccctgacgcagacagtggtcagcgttatttaacttatgaagagttggccgacgacctc
attccttacgcaaaagagatgggctatacccatctagagttattaccggtttcagagttt
ccgtttgatggttcgtggggctatcagccagtgggcatgtttgcgccaactagccgtttt
ggtaaccctgatgcatttaaatactttgtcgataaatgccaccaagctgatttaggggta
attattgattgggtgcctgcacatttcccggaagacggccatggtcttgcgcgctttgat
ggcagccatgtttatgaatatgaagatccaaggcgaggttggcatccggattggaattcg
tgcatttatgattttggcaaacagaccgttcgtcagtttctcgtcgccaatgcgttattt
tggttagataagttccacgtggatggattacgagtcgatgcggttgcttctatgctttat
ctcgattattcccgtaatgaaggcgagtggatcccgaatgtggatggcgggaatgaaaat
tacgaagccattagcctgctacgctggatgaatgaagaagtatataaacactatcctgac
gccatgactattgccgaagaatctacgtccttcccgaaagtatcacggcctgtgtttgaa
ggtggattaggttttggctttaagtggaatatgggctggatgcacgactcgctaacgtat
attgccaaagatcctgcttatcgtaattaccatcatggtgaaattaccttcagcatggtt
tattcctttgacgaaaatttcgtgttgcctatttctcatgatgaagtggtgcatggcaaa
ggcagcttattgcacaaaatgcccggtgatgaatggcagcaggccgctaacgtacggtgc
tatgctggctttatgtatgggcaccctggcaagaagttaaatttcatgggcaatgaattt
gcacaaagcaaagaatggaaccatgacaccagcttagattggcacctactggaacataaa
aaacacaaaggtattcaaagcttatataaagcattgaatcagttttataccagcactcct
gctatgtacgaacaagatcacagtcatcatggttttgcctgggttgaccatgaaaatgcc
gaccaaagtgtggtgtcttttgttcgcacgtcgctagatggtaagcaaaaagtctatgtt
atttgtaactttacgcctataccaagagaacattaccgcgtaggggtagatggggccggc
gagttggcacttgcactaaatactgatagtcaggtattttgggggagcgattatcctgtg
gacagccatgtcacgcctacgccggtagcatggaataaccgagaccactcgatcagtatt
aatttgccccctttatctaccgtattttacattacgaaatag

DBGET integrated database retrieval system