KEGG   Alteromonas mediterranea DE1: amad1_04730Help
Entry
amad1_04730       CDS       T02340                                 

Definition
(GenBank) putative glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amaa  Alteromonas mediterranea DE1
Pathway
amaa00040  Pentose and glucuronate interconversions
amaa00052  Galactose metabolism
amaa00500  Starch and sucrose metabolism
amaa00520  Amino sugar and nucleotide sugar metabolism
amaa01100  Metabolic pathways
amaa01130  Biosynthesis of antibiotics
Module
amaa_M00362  Nucleotide sugar biosynthesis, prokaryotes
amaa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amaa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    amad1_04730
   00052 Galactose metabolism
    amad1_04730
   00500 Starch and sucrose metabolism
    amad1_04730
   00520 Amino sugar and nucleotide sugar metabolism
    amad1_04730
Enzymes [BR:amaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     amad1_04730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD AstB
Motif
Other DBs
NCBI-ProteinID: AFV84470
Position
1054301..1055191
Genome map
AA seq 296 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSECVAAGLKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLEEVQSICPKDVTIMHIRQGVANGLGHAVLCARP
LIGDAPFAVVLPDVIIDDVASDPKKDNLADMVAKFNTSRVSQVMVEQVPDEDISKFGIAD
LDGAAIAPGDSAKIHKMVEKPPRDEAPSDLAVVGRYVLSEKIWDLLEFTPPGAGGEVQLT
DAIDALMKLEQVDAYYMKGKSHDCGSKLGYMKANVEYALRHPSLGDEFKEYLATVL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggttaaaaaagcggtaatccctgtagcaggtcttgggacgcgtatgcttccc
gcaacgaaagctattcctaaggaaatgctgccagttgtcgataagccgctaattcaatat
gtagttagtgaatgtgtcgctgcaggactaaaagaaatcattctcgttactcacgcaagt
aagaacagcattgaaaaccatttcgatacgtcttttgaacttgaagcaacgctagaaaag
cgtgttaagcgtcagcttttagaagaagttcagtcaatttgcccgaaagacgtaaccatt
atgcatattcgtcaaggtgtggcgaatggcttgggtcacgccgtgttgtgcgcccgtcct
cttattggtgatgcgccttttgccgtggttcttcctgacgttattattgatgatgttgcc
agcgaccctaaaaaagataaccttgcagacatggtggcgaagtttaatacaagtcgcgta
agtcaggttatggttgagcaagtaccggatgaagatatttctaagtttggtatcgctgat
ttagacggtgccgcaattgcgccaggcgattctgctaaaattcataaaatggtagaaaag
ccacctcgtgatgaagccccatcagatctagctgtagtgggcagatacgtgctttctgaa
aagatttgggatctgctagaatttactcctcctggagctggtggtgaagttcagcttact
gatgccattgatgcgctaatgaagcttgagcaagtggatgcttactacatgaaaggcaag
agccacgactgcggtagtaaactaggctatatgaaggcaaacgtagagtacgcacttcgt
cacccatctttaggcgatgagtttaaagaatacctagctactgtactttaa

DBGET integrated database retrieval system